Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3D8Y5

Protein Details
Accession S3D8Y5    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
169-194HKVQTREVVRLRRPRRHGSNSRELAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 10, cyto 5, plas 4, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038291  SAP30_C_sf  
IPR025718  SAP30_Sin3-bd  
Pfam View protein in Pfam  
PF13867  SAP30_Sin3_bdg  
Amino Acid Sequences MPPKPRVVADDVHGSKADAHKDKNGPNGSGAPGSGVHERQHAATNGKARRTAAASNASATAAAAAAVAAAAAATVVQTDPNPTLQWSEFDRGVLHAYQRAYKIDSPGAFSNEFSRWILSQPGSVGLHSPTSLRHKETRRQSKAQLANATRKHFNGLGVQENDIVVDFLHKVQTREVVRLRRPRRHGSNSRELAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.31
4 0.36
5 0.31
6 0.33
7 0.39
8 0.45
9 0.49
10 0.55
11 0.55
12 0.48
13 0.45
14 0.45
15 0.39
16 0.33
17 0.28
18 0.2
19 0.17
20 0.18
21 0.19
22 0.18
23 0.16
24 0.18
25 0.19
26 0.19
27 0.23
28 0.24
29 0.23
30 0.25
31 0.32
32 0.34
33 0.37
34 0.37
35 0.33
36 0.33
37 0.34
38 0.32
39 0.29
40 0.3
41 0.28
42 0.27
43 0.27
44 0.23
45 0.2
46 0.17
47 0.12
48 0.06
49 0.05
50 0.04
51 0.03
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.01
58 0.01
59 0.01
60 0.01
61 0.02
62 0.02
63 0.03
64 0.03
65 0.05
66 0.05
67 0.07
68 0.07
69 0.07
70 0.1
71 0.1
72 0.12
73 0.13
74 0.15
75 0.15
76 0.15
77 0.14
78 0.13
79 0.14
80 0.13
81 0.1
82 0.1
83 0.11
84 0.13
85 0.13
86 0.14
87 0.15
88 0.15
89 0.17
90 0.17
91 0.17
92 0.19
93 0.19
94 0.21
95 0.18
96 0.18
97 0.18
98 0.16
99 0.17
100 0.14
101 0.14
102 0.11
103 0.12
104 0.15
105 0.12
106 0.12
107 0.11
108 0.14
109 0.13
110 0.13
111 0.13
112 0.11
113 0.11
114 0.11
115 0.11
116 0.11
117 0.17
118 0.2
119 0.23
120 0.3
121 0.36
122 0.44
123 0.55
124 0.63
125 0.64
126 0.67
127 0.69
128 0.71
129 0.72
130 0.71
131 0.68
132 0.62
133 0.63
134 0.63
135 0.63
136 0.55
137 0.48
138 0.45
139 0.38
140 0.35
141 0.32
142 0.3
143 0.33
144 0.32
145 0.32
146 0.28
147 0.27
148 0.25
149 0.19
150 0.15
151 0.07
152 0.07
153 0.07
154 0.07
155 0.14
156 0.15
157 0.17
158 0.19
159 0.27
160 0.28
161 0.34
162 0.41
163 0.45
164 0.52
165 0.62
166 0.69
167 0.71
168 0.77
169 0.8
170 0.83
171 0.84
172 0.86
173 0.84
174 0.86