Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3CCN5

Protein Details
Accession S3CCN5    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
118-138AKSWRDTCKHCKEKAAKEQAAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 11, cyto_nucl 8.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MVNDPTPASITNTINTVKAVNTTTFPHSIKISSRSAVSFDRDTSYLTFSIIIRTQLYNAFDLHHVKMCIEQSVKIYCKNQGDCVFWGFHPFKNFIRDTYCSESYRTGRMCYSSGKDSAKSWRDTCKHCKEKAAKEQAARDQANGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.19
4 0.14
5 0.16
6 0.17
7 0.15
8 0.16
9 0.19
10 0.22
11 0.26
12 0.26
13 0.25
14 0.24
15 0.25
16 0.28
17 0.29
18 0.29
19 0.25
20 0.26
21 0.25
22 0.26
23 0.26
24 0.26
25 0.23
26 0.21
27 0.22
28 0.21
29 0.22
30 0.2
31 0.2
32 0.15
33 0.14
34 0.14
35 0.11
36 0.14
37 0.13
38 0.13
39 0.12
40 0.12
41 0.13
42 0.15
43 0.16
44 0.14
45 0.13
46 0.13
47 0.13
48 0.16
49 0.16
50 0.15
51 0.14
52 0.13
53 0.15
54 0.14
55 0.15
56 0.13
57 0.13
58 0.13
59 0.17
60 0.19
61 0.19
62 0.2
63 0.21
64 0.26
65 0.26
66 0.29
67 0.28
68 0.3
69 0.28
70 0.29
71 0.26
72 0.21
73 0.26
74 0.22
75 0.21
76 0.2
77 0.22
78 0.22
79 0.27
80 0.28
81 0.24
82 0.27
83 0.28
84 0.32
85 0.36
86 0.38
87 0.33
88 0.34
89 0.38
90 0.35
91 0.38
92 0.33
93 0.28
94 0.26
95 0.27
96 0.27
97 0.27
98 0.29
99 0.27
100 0.31
101 0.31
102 0.31
103 0.32
104 0.4
105 0.41
106 0.42
107 0.42
108 0.46
109 0.5
110 0.56
111 0.64
112 0.65
113 0.68
114 0.66
115 0.74
116 0.73
117 0.78
118 0.81
119 0.81
120 0.76
121 0.74
122 0.78
123 0.76
124 0.76
125 0.66