Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3BTX2

Protein Details
Accession S3BTX2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
31-55LYSVVVCPRHRRRRGRQSRDNSTSTHydrophilic
89-109GEKGPEKKEDKCKGPEKKGDABasic
NLS Segment(s)
PositionSequence
42-44RRR
Subcellular Location(s) extr 8, mito 7, cyto 6.5, cyto_nucl 6, nucl 4.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLYTNAPAIGYRNCNNVVPLPLYGPLLLFTLYSVVVCPRHRRRRGRQSRDNSTSTNDTSRDSGRVVDVTDAPEANDNGEGPSGAESGEGEKGPEKKEDKCKGPEKKGDAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.31
4 0.29
5 0.24
6 0.23
7 0.2
8 0.19
9 0.19
10 0.17
11 0.14
12 0.11
13 0.1
14 0.09
15 0.07
16 0.06
17 0.07
18 0.06
19 0.06
20 0.06
21 0.07
22 0.11
23 0.13
24 0.23
25 0.33
26 0.43
27 0.52
28 0.62
29 0.71
30 0.79
31 0.88
32 0.89
33 0.89
34 0.88
35 0.89
36 0.85
37 0.77
38 0.67
39 0.59
40 0.52
41 0.42
42 0.35
43 0.26
44 0.21
45 0.19
46 0.19
47 0.17
48 0.14
49 0.13
50 0.12
51 0.12
52 0.11
53 0.11
54 0.1
55 0.11
56 0.11
57 0.1
58 0.1
59 0.11
60 0.1
61 0.1
62 0.09
63 0.08
64 0.08
65 0.08
66 0.07
67 0.06
68 0.07
69 0.06
70 0.06
71 0.06
72 0.05
73 0.07
74 0.09
75 0.09
76 0.09
77 0.13
78 0.16
79 0.18
80 0.25
81 0.27
82 0.33
83 0.44
84 0.52
85 0.56
86 0.63
87 0.71
88 0.74
89 0.81
90 0.82