Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3CUM1

Protein Details
Accession S3CUM1    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
49-69AHGCRHCRRMTRRDARCVRRDBasic
NLS Segment(s)
Subcellular Location(s) nucl 12, extr 7, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MTIIGRLITAVLPDPIQPNNGYNNPSIAGANDTPIYYTSGSCGMCANSAHGCRHCRRMTRRDARCVRRDLREMRRAARWDTLLSPVTGRQQQSPQPIQQQQSQCSPMQYSRQQEPAYVPQQYGLAQQQQGRNAFREMSQKAPTPPPRRNSVYDVPAPEGPPPPYALNESGGRHGDKQHM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.16
4 0.16
5 0.18
6 0.23
7 0.27
8 0.28
9 0.26
10 0.26
11 0.25
12 0.25
13 0.22
14 0.16
15 0.17
16 0.15
17 0.16
18 0.14
19 0.13
20 0.13
21 0.14
22 0.15
23 0.11
24 0.11
25 0.11
26 0.14
27 0.14
28 0.14
29 0.14
30 0.12
31 0.13
32 0.14
33 0.15
34 0.15
35 0.18
36 0.21
37 0.24
38 0.29
39 0.31
40 0.4
41 0.43
42 0.47
43 0.53
44 0.59
45 0.66
46 0.71
47 0.76
48 0.77
49 0.82
50 0.81
51 0.8
52 0.79
53 0.72
54 0.68
55 0.67
56 0.65
57 0.65
58 0.64
59 0.6
60 0.55
61 0.56
62 0.52
63 0.48
64 0.42
65 0.34
66 0.28
67 0.26
68 0.26
69 0.21
70 0.18
71 0.16
72 0.14
73 0.16
74 0.17
75 0.17
76 0.15
77 0.18
78 0.22
79 0.28
80 0.31
81 0.3
82 0.34
83 0.38
84 0.38
85 0.41
86 0.41
87 0.37
88 0.38
89 0.38
90 0.32
91 0.28
92 0.27
93 0.24
94 0.26
95 0.29
96 0.29
97 0.3
98 0.35
99 0.34
100 0.34
101 0.35
102 0.36
103 0.34
104 0.31
105 0.28
106 0.22
107 0.23
108 0.22
109 0.21
110 0.16
111 0.16
112 0.18
113 0.22
114 0.24
115 0.28
116 0.32
117 0.31
118 0.31
119 0.29
120 0.27
121 0.26
122 0.31
123 0.29
124 0.3
125 0.32
126 0.33
127 0.36
128 0.44
129 0.51
130 0.52
131 0.57
132 0.57
133 0.61
134 0.63
135 0.64
136 0.63
137 0.61
138 0.59
139 0.57
140 0.55
141 0.5
142 0.47
143 0.43
144 0.38
145 0.34
146 0.29
147 0.25
148 0.25
149 0.23
150 0.23
151 0.26
152 0.26
153 0.26
154 0.28
155 0.29
156 0.31
157 0.32
158 0.32
159 0.31