Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DFE0

Protein Details
Accession B0DFE0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
129-167GGPSTEKKTKGRQRKTSTKAKAAEPKKRAGRPKKSAAVVHydrophilic
NLS Segment(s)
PositionSequence
111-163GKKAKKPRLSGDEAAEGEGGPSTEKKTKGRQRKTSTKAKAAEPKKRAGRPKKS
Subcellular Location(s) nucl 14, cyto_nucl 11, mito 6, cyto 6
Family & Domain DBs
KEGG lbc:LACBIDRAFT_294616  -  
Amino Acid Sequences MADNDIQQAELEEVIGTTEPEGQNEELAMNAEVGKDSTEPTALNEGEGQEFGVEASKAEEAGASKTKEGTEAATGEKREREELNEESQDLQGGDKEGEKKDEQEVAEKDTGKKAKKPRLSGDEAAEGEGGPSTEKKTKGRQRKTSTKAKAAEPKKRAGRPKKSAAVVEEGPAASAEGEPQEHQQETNVASEDVPAGHTRSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.11
6 0.11
7 0.12
8 0.15
9 0.15
10 0.15
11 0.15
12 0.15
13 0.09
14 0.11
15 0.1
16 0.08
17 0.08
18 0.07
19 0.07
20 0.07
21 0.08
22 0.07
23 0.08
24 0.08
25 0.09
26 0.09
27 0.11
28 0.16
29 0.15
30 0.15
31 0.15
32 0.15
33 0.15
34 0.14
35 0.12
36 0.07
37 0.07
38 0.06
39 0.07
40 0.06
41 0.05
42 0.06
43 0.06
44 0.06
45 0.06
46 0.07
47 0.07
48 0.1
49 0.14
50 0.14
51 0.14
52 0.15
53 0.15
54 0.16
55 0.15
56 0.14
57 0.11
58 0.12
59 0.14
60 0.16
61 0.17
62 0.17
63 0.19
64 0.18
65 0.19
66 0.19
67 0.19
68 0.21
69 0.23
70 0.26
71 0.25
72 0.24
73 0.22
74 0.22
75 0.19
76 0.14
77 0.11
78 0.07
79 0.07
80 0.07
81 0.07
82 0.1
83 0.1
84 0.13
85 0.13
86 0.14
87 0.15
88 0.19
89 0.17
90 0.2
91 0.2
92 0.21
93 0.23
94 0.23
95 0.22
96 0.24
97 0.29
98 0.25
99 0.31
100 0.36
101 0.43
102 0.49
103 0.54
104 0.57
105 0.6
106 0.64
107 0.61
108 0.55
109 0.5
110 0.43
111 0.38
112 0.3
113 0.22
114 0.15
115 0.12
116 0.09
117 0.05
118 0.05
119 0.08
120 0.12
121 0.16
122 0.2
123 0.3
124 0.4
125 0.51
126 0.61
127 0.68
128 0.74
129 0.82
130 0.85
131 0.86
132 0.84
133 0.82
134 0.76
135 0.73
136 0.73
137 0.71
138 0.73
139 0.67
140 0.68
141 0.68
142 0.72
143 0.74
144 0.75
145 0.77
146 0.76
147 0.82
148 0.8
149 0.76
150 0.72
151 0.65
152 0.6
153 0.5
154 0.43
155 0.35
156 0.27
157 0.22
158 0.18
159 0.15
160 0.09
161 0.08
162 0.08
163 0.07
164 0.08
165 0.09
166 0.12
167 0.16
168 0.16
169 0.16
170 0.17
171 0.19
172 0.2
173 0.22
174 0.2
175 0.17
176 0.16
177 0.17
178 0.16
179 0.13
180 0.13
181 0.12
182 0.13