Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CUV4

Protein Details
Accession S3CUV4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
160-181GVFIWWYKRRQAKARKPRIVAGHydrophilic
NLS Segment(s)
PositionSequence
168-177RRQAKARKPR
Subcellular Location(s) extr 10, cyto 7, plas 5, mito 4, cyto_pero 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG glz:GLAREA_12905  -  
CDD cd12087  TM_EGFR-like  
Amino Acid Sequences MKRAETTDSVILVTRTTIVDVSEPVTVKPTNTITSVVTFTPIISVTVTSTNSEDPPEFIAPTQTQESTPASTTLGISAPTTSPSNPLIPSSTGSTLKTSARPSVTSATSNASSQVTSSASTTSSETSTPTEQAASSGRGKSKGPVIGGAIGAIAFLVLLGVFIWWYKRRQAKARKPRIVAGYRAGDGEISKPAETGLARADSTPSRSWQTSPDAATNFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.1
4 0.1
5 0.09
6 0.1
7 0.11
8 0.12
9 0.14
10 0.14
11 0.13
12 0.17
13 0.17
14 0.16
15 0.19
16 0.21
17 0.2
18 0.21
19 0.22
20 0.2
21 0.22
22 0.23
23 0.19
24 0.18
25 0.15
26 0.14
27 0.13
28 0.12
29 0.1
30 0.09
31 0.09
32 0.09
33 0.11
34 0.12
35 0.12
36 0.13
37 0.14
38 0.14
39 0.16
40 0.15
41 0.13
42 0.16
43 0.16
44 0.15
45 0.13
46 0.17
47 0.15
48 0.18
49 0.19
50 0.16
51 0.15
52 0.17
53 0.19
54 0.17
55 0.17
56 0.15
57 0.13
58 0.13
59 0.13
60 0.11
61 0.1
62 0.08
63 0.08
64 0.08
65 0.08
66 0.09
67 0.1
68 0.09
69 0.11
70 0.12
71 0.14
72 0.14
73 0.14
74 0.14
75 0.14
76 0.15
77 0.15
78 0.16
79 0.16
80 0.16
81 0.16
82 0.17
83 0.17
84 0.19
85 0.18
86 0.19
87 0.19
88 0.19
89 0.2
90 0.22
91 0.22
92 0.19
93 0.18
94 0.17
95 0.17
96 0.16
97 0.15
98 0.11
99 0.1
100 0.09
101 0.09
102 0.08
103 0.07
104 0.08
105 0.07
106 0.07
107 0.08
108 0.09
109 0.09
110 0.09
111 0.09
112 0.09
113 0.11
114 0.12
115 0.12
116 0.11
117 0.11
118 0.1
119 0.11
120 0.12
121 0.13
122 0.14
123 0.16
124 0.17
125 0.19
126 0.19
127 0.2
128 0.23
129 0.23
130 0.21
131 0.2
132 0.2
133 0.2
134 0.19
135 0.17
136 0.12
137 0.08
138 0.07
139 0.05
140 0.04
141 0.02
142 0.02
143 0.02
144 0.01
145 0.02
146 0.02
147 0.02
148 0.02
149 0.03
150 0.06
151 0.09
152 0.12
153 0.19
154 0.26
155 0.34
156 0.44
157 0.55
158 0.64
159 0.72
160 0.82
161 0.83
162 0.8
163 0.8
164 0.79
165 0.73
166 0.66
167 0.62
168 0.55
169 0.46
170 0.43
171 0.36
172 0.27
173 0.22
174 0.2
175 0.17
176 0.15
177 0.14
178 0.13
179 0.13
180 0.16
181 0.15
182 0.15
183 0.15
184 0.15
185 0.16
186 0.16
187 0.2
188 0.19
189 0.24
190 0.26
191 0.26
192 0.29
193 0.31
194 0.32
195 0.34
196 0.38
197 0.39
198 0.4
199 0.42