Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CLA8

Protein Details
Accession S3CLA8    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-38EEGQQRAIYKRRKKPTPVTDDDYHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, nucl 9, cyto_nucl 8, cyto 5
Family & Domain DBs
KEGG glz:GLAREA_01916  -  
Amino Acid Sequences MAILIGSFGVGLGGREEGQQRAIYKRRKKPTPVTDDDYYCTHCTDSDSTGSDTLSASPQSLDPIQRLATLIVSASGSLEVHPSVGLILCHYSPATLLSPASARV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.08
3 0.1
4 0.11
5 0.13
6 0.16
7 0.17
8 0.24
9 0.32
10 0.4
11 0.49
12 0.58
13 0.66
14 0.72
15 0.78
16 0.81
17 0.83
18 0.83
19 0.8
20 0.77
21 0.71
22 0.65
23 0.58
24 0.49
25 0.42
26 0.32
27 0.26
28 0.19
29 0.15
30 0.15
31 0.14
32 0.14
33 0.13
34 0.14
35 0.14
36 0.14
37 0.14
38 0.12
39 0.1
40 0.09
41 0.08
42 0.07
43 0.06
44 0.06
45 0.06
46 0.08
47 0.09
48 0.1
49 0.09
50 0.11
51 0.11
52 0.11
53 0.12
54 0.1
55 0.09
56 0.08
57 0.08
58 0.06
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.06
66 0.06
67 0.06
68 0.06
69 0.05
70 0.05
71 0.06
72 0.06
73 0.06
74 0.08
75 0.08
76 0.09
77 0.09
78 0.09
79 0.09
80 0.11
81 0.12
82 0.12
83 0.12
84 0.13