Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3DYY0

Protein Details
Accession S3DYY0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSCFSPRTPRKKPRLTIALFTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 13.5, cyto 4.5
Family & Domain DBs
KEGG glz:GLAREA_09309  -  
Amino Acid Sequences MSCFSPRTPRKKPRLTIALFTLPQKGKYHYTFLLTPKPSSPPVSTRGDPANPTPLVKFSVEKREKGAGRGWDVRRGKEVKEVQWVFERGEIPDLEMAAGLHCLVTVGKVLDVLALEEILAEVEIEGEKGFDSEAWVGEAFERCRSRGVVTGKSGVSGREVRWRELEEEIGEFARRMGTRERDEVGWMGEEGVPCWDVLGGGVYAMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.82
3 0.77
4 0.73
5 0.7
6 0.62
7 0.56
8 0.54
9 0.45
10 0.44
11 0.4
12 0.38
13 0.36
14 0.38
15 0.43
16 0.37
17 0.39
18 0.41
19 0.43
20 0.48
21 0.43
22 0.41
23 0.37
24 0.39
25 0.38
26 0.37
27 0.36
28 0.31
29 0.34
30 0.39
31 0.37
32 0.37
33 0.4
34 0.38
35 0.36
36 0.35
37 0.36
38 0.3
39 0.3
40 0.27
41 0.23
42 0.23
43 0.22
44 0.22
45 0.2
46 0.3
47 0.33
48 0.33
49 0.35
50 0.41
51 0.4
52 0.4
53 0.42
54 0.35
55 0.37
56 0.45
57 0.42
58 0.44
59 0.45
60 0.43
61 0.44
62 0.42
63 0.37
64 0.37
65 0.4
66 0.34
67 0.42
68 0.41
69 0.37
70 0.4
71 0.39
72 0.31
73 0.29
74 0.27
75 0.17
76 0.18
77 0.16
78 0.12
79 0.11
80 0.11
81 0.08
82 0.07
83 0.06
84 0.04
85 0.04
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.05
119 0.05
120 0.05
121 0.06
122 0.07
123 0.07
124 0.08
125 0.12
126 0.11
127 0.17
128 0.18
129 0.17
130 0.19
131 0.2
132 0.21
133 0.25
134 0.3
135 0.3
136 0.31
137 0.35
138 0.33
139 0.34
140 0.32
141 0.25
142 0.24
143 0.21
144 0.2
145 0.25
146 0.27
147 0.28
148 0.31
149 0.33
150 0.31
151 0.3
152 0.31
153 0.23
154 0.22
155 0.21
156 0.18
157 0.16
158 0.14
159 0.12
160 0.14
161 0.13
162 0.15
163 0.21
164 0.28
165 0.33
166 0.37
167 0.4
168 0.36
169 0.38
170 0.37
171 0.31
172 0.24
173 0.19
174 0.17
175 0.16
176 0.15
177 0.13
178 0.13
179 0.12
180 0.1
181 0.1
182 0.09
183 0.07
184 0.07
185 0.08
186 0.07