Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0D4X6

Protein Details
Accession B0D4X6    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-48GRAQHHVSRTCQRRHLKRGTHNIEKEIHydrophilic
344-367VMQLYRQRRSEKYKVPKEWSEKVAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 7, golg 3, nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG lbc:LACBIDRAFT_293649  -  
Amino Acid Sequences MVRVIKLLRVASFKFHFAISGGRAQHHVSRTCQRRHLKRGTHNIEKEIEFEGNNKIIAHDSEGFEAGKQAEVDVVWKFIDSRSRAKDINQKLHLVWFVLPLFLIMGKLSRIAAVPVVAIVTKFDTFLQDMQQKLEEKAEEEDEEVDDDELEKIAGVEADKRFEQHYKKPLESMQHPPRAVVTLSEETQRQARNGYDLRTFFASAQSADSKIKLITSAVNGLNWNYHKNYSEKMFRGGPFIKTWDTFWTDSTSGPQAPIKLIRLLEKHLDDSRRLIGHRQSSDFSEVNAHPNLMAFCRWEQRVADTVLIMEKVYVFNINDEKTLEAMIKWYDQGSNTATYIRKEVMQLYRQRRSEKYKVPKEWSEKVAQPLIDLVCKRPVEVPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.27
4 0.22
5 0.26
6 0.22
7 0.26
8 0.25
9 0.25
10 0.27
11 0.29
12 0.34
13 0.36
14 0.37
15 0.37
16 0.45
17 0.53
18 0.59
19 0.66
20 0.7
21 0.74
22 0.8
23 0.84
24 0.84
25 0.85
26 0.89
27 0.88
28 0.88
29 0.82
30 0.77
31 0.71
32 0.62
33 0.53
34 0.45
35 0.37
36 0.27
37 0.24
38 0.24
39 0.2
40 0.2
41 0.18
42 0.16
43 0.16
44 0.17
45 0.19
46 0.18
47 0.18
48 0.19
49 0.2
50 0.2
51 0.18
52 0.19
53 0.14
54 0.13
55 0.11
56 0.1
57 0.09
58 0.09
59 0.11
60 0.1
61 0.1
62 0.08
63 0.09
64 0.09
65 0.11
66 0.18
67 0.2
68 0.28
69 0.32
70 0.37
71 0.38
72 0.43
73 0.51
74 0.53
75 0.59
76 0.55
77 0.52
78 0.48
79 0.5
80 0.45
81 0.37
82 0.28
83 0.21
84 0.18
85 0.15
86 0.14
87 0.11
88 0.1
89 0.09
90 0.08
91 0.05
92 0.05
93 0.05
94 0.06
95 0.06
96 0.07
97 0.07
98 0.07
99 0.08
100 0.07
101 0.07
102 0.06
103 0.06
104 0.06
105 0.05
106 0.05
107 0.06
108 0.06
109 0.07
110 0.07
111 0.09
112 0.1
113 0.11
114 0.16
115 0.18
116 0.19
117 0.19
118 0.23
119 0.23
120 0.22
121 0.24
122 0.18
123 0.16
124 0.18
125 0.18
126 0.15
127 0.14
128 0.14
129 0.11
130 0.11
131 0.1
132 0.08
133 0.06
134 0.06
135 0.06
136 0.05
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.09
144 0.09
145 0.11
146 0.12
147 0.13
148 0.14
149 0.2
150 0.25
151 0.27
152 0.35
153 0.38
154 0.39
155 0.4
156 0.42
157 0.42
158 0.41
159 0.44
160 0.45
161 0.46
162 0.46
163 0.43
164 0.41
165 0.37
166 0.32
167 0.22
168 0.18
169 0.13
170 0.14
171 0.15
172 0.15
173 0.14
174 0.17
175 0.17
176 0.13
177 0.13
178 0.13
179 0.17
180 0.18
181 0.2
182 0.21
183 0.21
184 0.22
185 0.21
186 0.22
187 0.16
188 0.16
189 0.14
190 0.1
191 0.12
192 0.11
193 0.12
194 0.11
195 0.11
196 0.11
197 0.1
198 0.1
199 0.08
200 0.08
201 0.08
202 0.09
203 0.13
204 0.13
205 0.13
206 0.13
207 0.13
208 0.16
209 0.15
210 0.17
211 0.14
212 0.15
213 0.16
214 0.18
215 0.21
216 0.23
217 0.29
218 0.28
219 0.3
220 0.32
221 0.31
222 0.36
223 0.35
224 0.32
225 0.27
226 0.28
227 0.27
228 0.23
229 0.23
230 0.21
231 0.23
232 0.21
233 0.21
234 0.22
235 0.21
236 0.2
237 0.22
238 0.2
239 0.16
240 0.17
241 0.17
242 0.14
243 0.15
244 0.18
245 0.17
246 0.18
247 0.19
248 0.22
249 0.23
250 0.25
251 0.28
252 0.27
253 0.29
254 0.3
255 0.32
256 0.28
257 0.29
258 0.31
259 0.28
260 0.28
261 0.29
262 0.31
263 0.36
264 0.39
265 0.39
266 0.36
267 0.36
268 0.41
269 0.36
270 0.3
271 0.28
272 0.25
273 0.26
274 0.25
275 0.22
276 0.17
277 0.18
278 0.18
279 0.14
280 0.14
281 0.12
282 0.14
283 0.2
284 0.2
285 0.22
286 0.22
287 0.24
288 0.28
289 0.28
290 0.26
291 0.2
292 0.2
293 0.19
294 0.18
295 0.14
296 0.09
297 0.08
298 0.08
299 0.08
300 0.1
301 0.09
302 0.13
303 0.17
304 0.18
305 0.18
306 0.19
307 0.19
308 0.17
309 0.17
310 0.14
311 0.1
312 0.12
313 0.12
314 0.12
315 0.12
316 0.13
317 0.14
318 0.14
319 0.17
320 0.18
321 0.19
322 0.18
323 0.22
324 0.23
325 0.23
326 0.25
327 0.23
328 0.23
329 0.22
330 0.28
331 0.32
332 0.38
333 0.46
334 0.53
335 0.6
336 0.64
337 0.68
338 0.69
339 0.7
340 0.72
341 0.73
342 0.75
343 0.77
344 0.81
345 0.84
346 0.85
347 0.84
348 0.82
349 0.77
350 0.73
351 0.68
352 0.65
353 0.62
354 0.52
355 0.44
356 0.41
357 0.37
358 0.36
359 0.32
360 0.29
361 0.31
362 0.31
363 0.32