Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3DIU6

Protein Details
Accession S3DIU6    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
75-94KISWAKAVPRISRRKGKQRTHydrophilic
NLS Segment(s)
PositionSequence
83-93PRISRRKGKQR
Subcellular Location(s) nucl 10, cyto_nucl 9.5, cyto 7, mito 6, pero 2
Family & Domain DBs
KEGG glz:GLAREA_12038  -  
Amino Acid Sequences MPKQELEMWWTNPNGCYCEDTSPRGPEIPLRDLMVCGRQNFAELVWTTMSVREWSVLRLTRGKVLELSGQHDFQKISWAKAVPRISRRKGKQRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.23
4 0.22
5 0.27
6 0.29
7 0.31
8 0.34
9 0.35
10 0.35
11 0.32
12 0.3
13 0.28
14 0.3
15 0.28
16 0.25
17 0.23
18 0.22
19 0.22
20 0.23
21 0.25
22 0.22
23 0.19
24 0.18
25 0.16
26 0.17
27 0.16
28 0.15
29 0.12
30 0.1
31 0.1
32 0.09
33 0.1
34 0.09
35 0.1
36 0.1
37 0.07
38 0.07
39 0.07
40 0.07
41 0.08
42 0.12
43 0.14
44 0.16
45 0.2
46 0.2
47 0.24
48 0.25
49 0.25
50 0.21
51 0.21
52 0.23
53 0.2
54 0.23
55 0.21
56 0.22
57 0.21
58 0.22
59 0.21
60 0.17
61 0.25
62 0.22
63 0.22
64 0.25
65 0.27
66 0.27
67 0.35
68 0.43
69 0.41
70 0.5
71 0.58
72 0.62
73 0.7
74 0.78