Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0DZK2

Protein Details
Accession B0DZK2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
39-58SPEVKRPDRTAKNRSLRSFCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 12.5, cyto 8.5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_315013  -  
Amino Acid Sequences MLSPKTFSAVAKLVFESPVRSGFLMPRGINRNRNWSAFSPEVKRPDRTAKNRSLRSFCGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.18
4 0.15
5 0.16
6 0.15
7 0.14
8 0.14
9 0.14
10 0.18
11 0.2
12 0.19
13 0.22
14 0.28
15 0.32
16 0.38
17 0.37
18 0.43
19 0.41
20 0.42
21 0.41
22 0.36
23 0.39
24 0.36
25 0.38
26 0.34
27 0.37
28 0.44
29 0.44
30 0.45
31 0.43
32 0.49
33 0.56
34 0.6
35 0.63
36 0.66
37 0.73
38 0.79
39 0.82
40 0.78