Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3DH85

Protein Details
Accession S3DH85    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
194-215EETAHVPKKRKTRSSIKKEEFNHydrophilic
NLS Segment(s)
PositionSequence
201-208KKRKTRSS
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR025494  DUF4385  
KEGG glz:GLAREA_09238  -  
Pfam View protein in Pfam  
PF14328  DUF4385  
Amino Acid Sequences MTITSSTTKSDETSRSPATLLQMTTLTRPPASEYYAYRIARGEQGVLTFEPYKSHLLPHWRFRTVPIARTSSTTLYEHFLSFCEGDDFVGMDMARKFIQMGMTRSKRYANYKGGKKYDGGKEGGVQREKSKGHEGREEKEEASRIFKEVWERCKAHEGYQRLKERFLVEQKRWEKAQKEIGKIKSETEAKVEEEETAHVPKKRKTRSSIKKEEFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.35
4 0.35
5 0.34
6 0.33
7 0.27
8 0.22
9 0.22
10 0.21
11 0.24
12 0.25
13 0.22
14 0.19
15 0.19
16 0.22
17 0.22
18 0.25
19 0.26
20 0.25
21 0.3
22 0.38
23 0.37
24 0.34
25 0.32
26 0.3
27 0.3
28 0.28
29 0.23
30 0.15
31 0.16
32 0.17
33 0.16
34 0.17
35 0.15
36 0.14
37 0.14
38 0.16
39 0.18
40 0.17
41 0.18
42 0.19
43 0.28
44 0.34
45 0.43
46 0.47
47 0.46
48 0.46
49 0.46
50 0.52
51 0.45
52 0.46
53 0.41
54 0.38
55 0.37
56 0.39
57 0.39
58 0.3
59 0.3
60 0.24
61 0.2
62 0.19
63 0.19
64 0.17
65 0.15
66 0.13
67 0.12
68 0.11
69 0.11
70 0.09
71 0.08
72 0.08
73 0.07
74 0.07
75 0.05
76 0.06
77 0.06
78 0.06
79 0.06
80 0.08
81 0.07
82 0.07
83 0.07
84 0.07
85 0.12
86 0.14
87 0.17
88 0.25
89 0.28
90 0.29
91 0.3
92 0.32
93 0.31
94 0.34
95 0.38
96 0.38
97 0.43
98 0.5
99 0.56
100 0.56
101 0.54
102 0.49
103 0.48
104 0.45
105 0.4
106 0.34
107 0.27
108 0.28
109 0.31
110 0.35
111 0.31
112 0.27
113 0.24
114 0.29
115 0.29
116 0.29
117 0.34
118 0.33
119 0.35
120 0.43
121 0.44
122 0.42
123 0.46
124 0.45
125 0.36
126 0.33
127 0.33
128 0.25
129 0.26
130 0.23
131 0.2
132 0.18
133 0.19
134 0.25
135 0.28
136 0.33
137 0.36
138 0.37
139 0.38
140 0.46
141 0.45
142 0.45
143 0.47
144 0.47
145 0.48
146 0.56
147 0.63
148 0.55
149 0.55
150 0.5
151 0.46
152 0.47
153 0.49
154 0.49
155 0.44
156 0.53
157 0.55
158 0.58
159 0.58
160 0.57
161 0.51
162 0.49
163 0.56
164 0.53
165 0.58
166 0.61
167 0.63
168 0.63
169 0.61
170 0.55
171 0.52
172 0.48
173 0.41
174 0.37
175 0.34
176 0.29
177 0.3
178 0.29
179 0.22
180 0.19
181 0.2
182 0.19
183 0.21
184 0.24
185 0.27
186 0.33
187 0.38
188 0.48
189 0.56
190 0.62
191 0.66
192 0.73
193 0.79
194 0.84
195 0.89