Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3D1F1

Protein Details
Accession S3D1F1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-33LEDAERAKRYKNRAEPQKKGKGSSHydrophilic
NLS Segment(s)
PositionSequence
16-31AKRYKNRAEPQKKGKG
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
KEGG glz:GLAREA_01753  -  
Amino Acid Sequences MDALLALQNLEDAERAKRYKNRAEPQKKGKGSSSKSQDLAAQNAARNEKAGRAIQRSRSQASSRSAGVPSRAASQSSGRARSRAQETLDNYEIPSRVGAQSPAPSRDSRRISFSEPSKPEGTKLWIPTKTESLASGFEYDPRLQKFNVGEHEWRDFTTQLIAAANVKGSKLTWPFRKRKVIARIKRDLQYGGDITAVFKSWNKVFKIQRFQAWLELPGEKSAPLPGNDEHEVVDVKKFRILVNPSKERAPSVYSRSNSLTASISGEGMKAVEGRKEVEADDDADAEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.29
4 0.35
5 0.44
6 0.53
7 0.62
8 0.69
9 0.74
10 0.82
11 0.85
12 0.89
13 0.91
14 0.85
15 0.79
16 0.77
17 0.76
18 0.71
19 0.71
20 0.69
21 0.64
22 0.61
23 0.58
24 0.55
25 0.48
26 0.46
27 0.41
28 0.36
29 0.32
30 0.35
31 0.36
32 0.3
33 0.28
34 0.26
35 0.23
36 0.24
37 0.27
38 0.29
39 0.35
40 0.41
41 0.48
42 0.54
43 0.57
44 0.56
45 0.56
46 0.53
47 0.52
48 0.5
49 0.45
50 0.39
51 0.37
52 0.35
53 0.32
54 0.3
55 0.26
56 0.22
57 0.24
58 0.23
59 0.2
60 0.2
61 0.21
62 0.27
63 0.31
64 0.36
65 0.32
66 0.34
67 0.34
68 0.39
69 0.41
70 0.38
71 0.35
72 0.35
73 0.37
74 0.42
75 0.42
76 0.36
77 0.31
78 0.29
79 0.26
80 0.19
81 0.16
82 0.11
83 0.1
84 0.11
85 0.12
86 0.11
87 0.17
88 0.19
89 0.22
90 0.22
91 0.23
92 0.26
93 0.34
94 0.38
95 0.34
96 0.36
97 0.37
98 0.39
99 0.43
100 0.43
101 0.44
102 0.4
103 0.43
104 0.4
105 0.37
106 0.34
107 0.3
108 0.31
109 0.26
110 0.29
111 0.31
112 0.31
113 0.33
114 0.34
115 0.34
116 0.3
117 0.26
118 0.22
119 0.16
120 0.15
121 0.13
122 0.14
123 0.11
124 0.11
125 0.13
126 0.13
127 0.15
128 0.16
129 0.17
130 0.14
131 0.18
132 0.18
133 0.2
134 0.23
135 0.23
136 0.23
137 0.23
138 0.26
139 0.23
140 0.22
141 0.2
142 0.16
143 0.13
144 0.12
145 0.11
146 0.09
147 0.08
148 0.08
149 0.07
150 0.07
151 0.08
152 0.07
153 0.06
154 0.06
155 0.06
156 0.1
157 0.14
158 0.21
159 0.3
160 0.39
161 0.47
162 0.55
163 0.64
164 0.63
165 0.67
166 0.72
167 0.74
168 0.73
169 0.75
170 0.75
171 0.71
172 0.72
173 0.64
174 0.55
175 0.45
176 0.4
177 0.32
178 0.24
179 0.19
180 0.15
181 0.14
182 0.13
183 0.11
184 0.08
185 0.08
186 0.11
187 0.14
188 0.2
189 0.22
190 0.3
191 0.38
192 0.46
193 0.55
194 0.55
195 0.57
196 0.56
197 0.54
198 0.52
199 0.46
200 0.4
201 0.32
202 0.3
203 0.26
204 0.22
205 0.21
206 0.15
207 0.14
208 0.15
209 0.16
210 0.15
211 0.18
212 0.18
213 0.24
214 0.25
215 0.25
216 0.22
217 0.2
218 0.2
219 0.17
220 0.21
221 0.19
222 0.18
223 0.2
224 0.2
225 0.19
226 0.26
227 0.33
228 0.37
229 0.44
230 0.51
231 0.51
232 0.54
233 0.55
234 0.49
235 0.45
236 0.41
237 0.37
238 0.37
239 0.44
240 0.41
241 0.44
242 0.46
243 0.45
244 0.4
245 0.36
246 0.3
247 0.22
248 0.24
249 0.2
250 0.17
251 0.15
252 0.15
253 0.13
254 0.11
255 0.1
256 0.1
257 0.11
258 0.13
259 0.14
260 0.17
261 0.19
262 0.2
263 0.19
264 0.21
265 0.21
266 0.2
267 0.2