Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3E1M8

Protein Details
Accession S3E1M8   
Localization Confidence High
Confidence Score 19.5
NoLS Segment(s)
PositionSequenceProtein Nature
103-125LDRSRRKLEKKAKLYKEMKRRDYBasic
282-315EAERKETERLRKERDEKKDKRKKELEERRKAISEBasic
NLS Segment(s)
PositionSequence
51-54RPSK
70-70K
85-93RRARGGPKK
105-123RSRRKLEKKAKLYKEMKRR
285-320RKETERLRKERDEKKDKRKKELEERRKAISEKRAKK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025066  CCDC174-like  
KEGG glz:GLAREA_07516  -  
Pfam View protein in Pfam  
PF13300  DUF4078  
Amino Acid Sequences MAPPSPTSLYNQRKAKIHSANDTTSSNSLAFSSTISSLLTSSTPATRGRPRPSKAPKDDIFSSHNRNTKKRAAKDLEHDSDSEGRRARGGPKKDLGSVDDAILDRSRRKLEKKAKLYKEMKRRDYIPKEGEEELVDFDRKWVDRDAKGEVSSSDSEVDDGGEMVDYEDEYGRLRRGTKADAERMERRKLNKVLGQEELDRISARPAQPEKVIYGDTVQTLAFNPDEEIHEKMEALAGKRDRSMTPPEQRHYEADKEFRIRGVGFYNFSKDEEGRKREMEALEAERKETERLRKERDEKKDKRKKELEERRKAISEKRAKKQAESFLDNLGADLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.7
3 0.69
4 0.67
5 0.67
6 0.67
7 0.65
8 0.61
9 0.57
10 0.5
11 0.41
12 0.36
13 0.27
14 0.21
15 0.17
16 0.15
17 0.13
18 0.11
19 0.12
20 0.11
21 0.11
22 0.11
23 0.11
24 0.1
25 0.11
26 0.1
27 0.09
28 0.1
29 0.12
30 0.14
31 0.16
32 0.22
33 0.3
34 0.38
35 0.47
36 0.55
37 0.57
38 0.66
39 0.74
40 0.79
41 0.78
42 0.79
43 0.73
44 0.71
45 0.7
46 0.63
47 0.58
48 0.53
49 0.53
50 0.5
51 0.52
52 0.51
53 0.53
54 0.55
55 0.59
56 0.63
57 0.62
58 0.66
59 0.68
60 0.69
61 0.73
62 0.75
63 0.71
64 0.62
65 0.55
66 0.47
67 0.45
68 0.41
69 0.36
70 0.28
71 0.24
72 0.24
73 0.26
74 0.33
75 0.35
76 0.4
77 0.42
78 0.46
79 0.48
80 0.5
81 0.49
82 0.42
83 0.38
84 0.33
85 0.25
86 0.21
87 0.19
88 0.17
89 0.17
90 0.16
91 0.14
92 0.16
93 0.21
94 0.25
95 0.3
96 0.39
97 0.48
98 0.57
99 0.66
100 0.73
101 0.75
102 0.8
103 0.84
104 0.81
105 0.81
106 0.81
107 0.76
108 0.7
109 0.68
110 0.68
111 0.66
112 0.66
113 0.6
114 0.53
115 0.51
116 0.47
117 0.43
118 0.33
119 0.26
120 0.19
121 0.16
122 0.14
123 0.1
124 0.1
125 0.11
126 0.11
127 0.12
128 0.15
129 0.19
130 0.2
131 0.23
132 0.27
133 0.26
134 0.26
135 0.25
136 0.21
137 0.19
138 0.18
139 0.16
140 0.12
141 0.1
142 0.1
143 0.09
144 0.09
145 0.05
146 0.05
147 0.04
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.04
156 0.04
157 0.05
158 0.06
159 0.08
160 0.09
161 0.12
162 0.14
163 0.16
164 0.22
165 0.27
166 0.32
167 0.34
168 0.39
169 0.43
170 0.46
171 0.49
172 0.45
173 0.43
174 0.46
175 0.46
176 0.46
177 0.42
178 0.43
179 0.4
180 0.4
181 0.39
182 0.31
183 0.29
184 0.24
185 0.21
186 0.16
187 0.13
188 0.13
189 0.14
190 0.13
191 0.19
192 0.2
193 0.22
194 0.23
195 0.25
196 0.23
197 0.21
198 0.21
199 0.15
200 0.14
201 0.13
202 0.11
203 0.11
204 0.09
205 0.08
206 0.08
207 0.09
208 0.08
209 0.07
210 0.08
211 0.08
212 0.1
213 0.12
214 0.13
215 0.13
216 0.13
217 0.13
218 0.12
219 0.14
220 0.13
221 0.13
222 0.18
223 0.19
224 0.2
225 0.21
226 0.24
227 0.22
228 0.24
229 0.31
230 0.34
231 0.41
232 0.48
233 0.5
234 0.53
235 0.54
236 0.55
237 0.52
238 0.5
239 0.45
240 0.43
241 0.44
242 0.43
243 0.41
244 0.37
245 0.35
246 0.28
247 0.25
248 0.25
249 0.23
250 0.22
251 0.23
252 0.26
253 0.25
254 0.25
255 0.26
256 0.23
257 0.29
258 0.36
259 0.39
260 0.4
261 0.4
262 0.41
263 0.43
264 0.42
265 0.36
266 0.32
267 0.34
268 0.37
269 0.36
270 0.35
271 0.31
272 0.32
273 0.32
274 0.34
275 0.37
276 0.39
277 0.47
278 0.55
279 0.63
280 0.72
281 0.78
282 0.82
283 0.84
284 0.84
285 0.87
286 0.9
287 0.87
288 0.89
289 0.88
290 0.88
291 0.88
292 0.89
293 0.89
294 0.89
295 0.86
296 0.82
297 0.79
298 0.73
299 0.7
300 0.69
301 0.69
302 0.68
303 0.73
304 0.75
305 0.72
306 0.75
307 0.75
308 0.75
309 0.73
310 0.69
311 0.61
312 0.55
313 0.55
314 0.47