Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3DU60

Protein Details
Accession S3DU60   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
93-115GWGGKARKRAKKVEKMREEKMRABasic
NLS Segment(s)
PositionSequence
95-115GGKARKRAKKVEKMREEKMRA
Subcellular Location(s) nucl 13.5, cyto 11, mito_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
KEGG glz:GLAREA_01108  -  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MDILNFLSTMGKRLAHNTKHSLTDLSIQNYIRLVAIVGAYLLLRPYLMKAVEKTQGMHLKKEIEGVKVTPNMIREGGKKVEGEGEVKGDDDGGWGGKARKRAKKVEKMREEKMRAKEGDEEDRDIEEFLVDGKDVRDLLVDYEEGVDGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.44
4 0.49
5 0.5
6 0.51
7 0.51
8 0.45
9 0.37
10 0.38
11 0.36
12 0.32
13 0.33
14 0.29
15 0.29
16 0.27
17 0.26
18 0.18
19 0.13
20 0.1
21 0.07
22 0.07
23 0.06
24 0.05
25 0.05
26 0.04
27 0.05
28 0.04
29 0.04
30 0.04
31 0.04
32 0.05
33 0.07
34 0.09
35 0.1
36 0.12
37 0.16
38 0.2
39 0.2
40 0.21
41 0.24
42 0.32
43 0.31
44 0.31
45 0.3
46 0.28
47 0.27
48 0.32
49 0.27
50 0.21
51 0.21
52 0.2
53 0.21
54 0.2
55 0.2
56 0.16
57 0.15
58 0.14
59 0.15
60 0.15
61 0.13
62 0.16
63 0.17
64 0.17
65 0.16
66 0.15
67 0.16
68 0.16
69 0.15
70 0.12
71 0.12
72 0.1
73 0.1
74 0.1
75 0.07
76 0.06
77 0.05
78 0.05
79 0.04
80 0.05
81 0.06
82 0.09
83 0.11
84 0.19
85 0.27
86 0.35
87 0.41
88 0.51
89 0.6
90 0.68
91 0.77
92 0.8
93 0.83
94 0.82
95 0.84
96 0.83
97 0.8
98 0.77
99 0.73
100 0.7
101 0.6
102 0.55
103 0.55
104 0.49
105 0.52
106 0.46
107 0.42
108 0.36
109 0.36
110 0.34
111 0.27
112 0.22
113 0.13
114 0.1
115 0.08
116 0.08
117 0.06
118 0.07
119 0.07
120 0.09
121 0.09
122 0.09
123 0.1
124 0.1
125 0.11
126 0.13
127 0.13
128 0.11
129 0.12