Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3CUU9

Protein Details
Accession S3CUU9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
110-143DGKGTSKKLRSRLRATPRKRQNKMSLRARSQARRHydrophilic
NLS Segment(s)
PositionSequence
110-143DGKGTSKKLRSRLRATPRKRQNKMSLRARSQARR
Subcellular Location(s) nucl 11.5, cyto_nucl 11, cyto 9.5, cysk 4
Family & Domain DBs
KEGG glz:GLAREA_12900  -  
Amino Acid Sequences MGPHDLTDEQLLQMLAAVLAQVHKETFWKFIDKNVSWEVVSIILGIDGIGTTTRRFDKVYEMLKARITFEESAKSKKRKAEMVEAEDGNMADGEEEEGARPTKRLRLDEDGKGTSKKLRSRLRATPRKRQNKMSLRARSQARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.07
3 0.05
4 0.05
5 0.04
6 0.05
7 0.05
8 0.06
9 0.06
10 0.06
11 0.09
12 0.11
13 0.15
14 0.16
15 0.22
16 0.22
17 0.27
18 0.37
19 0.35
20 0.39
21 0.37
22 0.36
23 0.3
24 0.3
25 0.25
26 0.16
27 0.14
28 0.09
29 0.07
30 0.05
31 0.05
32 0.04
33 0.03
34 0.02
35 0.03
36 0.03
37 0.04
38 0.04
39 0.07
40 0.08
41 0.1
42 0.11
43 0.12
44 0.17
45 0.24
46 0.28
47 0.3
48 0.31
49 0.31
50 0.33
51 0.33
52 0.28
53 0.21
54 0.2
55 0.16
56 0.15
57 0.2
58 0.19
59 0.25
60 0.3
61 0.33
62 0.34
63 0.37
64 0.4
65 0.4
66 0.43
67 0.47
68 0.47
69 0.49
70 0.49
71 0.45
72 0.41
73 0.35
74 0.31
75 0.21
76 0.13
77 0.08
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.06
85 0.07
86 0.07
87 0.08
88 0.1
89 0.16
90 0.21
91 0.24
92 0.29
93 0.37
94 0.42
95 0.48
96 0.52
97 0.5
98 0.47
99 0.45
100 0.41
101 0.38
102 0.39
103 0.39
104 0.42
105 0.49
106 0.55
107 0.62
108 0.71
109 0.76
110 0.8
111 0.82
112 0.83
113 0.84
114 0.86
115 0.85
116 0.85
117 0.85
118 0.85
119 0.87
120 0.87
121 0.86
122 0.81
123 0.83