Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3DGG1

Protein Details
Accession S3DGG1   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
224-250QIELAKAGRPRKRGKRRMCDCGCKSIIHydrophilic
NLS Segment(s)
PositionSequence
229-240KAGRPRKRGKRR
Subcellular Location(s) nucl 18, cyto 4, mito 3
Family & Domain DBs
KEGG glz:GLAREA_05557  -  
Amino Acid Sequences MSVGVGLGITLRTEHFSSPASSFLTRTEKSLKNQELRRMLAVESSSECWLPSRKNPSPYPPVKTPRQSSLQGLEGSFAGHPPYEHSDSNTPTVFTPSNSTPSTYTASTPSSVPSYQMSHDEYAFPTLPAHSVQASKNNTVFLHEDYNSFGNYQATPSPSTPTPTETLTTPSPVLGPPSTVPTITVYNWAVPVTPINYHALRNVHGGLQDAPEEIPKTQLSRAIQIELAKAGRPRKRGKRRMCDCGCKSIIQPYVIKRHMKTARRVVGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.16
4 0.19
5 0.19
6 0.21
7 0.21
8 0.21
9 0.21
10 0.24
11 0.3
12 0.28
13 0.31
14 0.36
15 0.39
16 0.44
17 0.54
18 0.57
19 0.58
20 0.64
21 0.69
22 0.68
23 0.65
24 0.61
25 0.53
26 0.44
27 0.39
28 0.33
29 0.26
30 0.21
31 0.21
32 0.19
33 0.17
34 0.17
35 0.16
36 0.2
37 0.22
38 0.27
39 0.35
40 0.4
41 0.48
42 0.53
43 0.59
44 0.65
45 0.67
46 0.67
47 0.66
48 0.67
49 0.67
50 0.71
51 0.67
52 0.63
53 0.62
54 0.58
55 0.53
56 0.5
57 0.46
58 0.39
59 0.34
60 0.28
61 0.22
62 0.2
63 0.16
64 0.12
65 0.08
66 0.07
67 0.07
68 0.09
69 0.15
70 0.18
71 0.18
72 0.22
73 0.26
74 0.28
75 0.31
76 0.28
77 0.23
78 0.2
79 0.23
80 0.2
81 0.16
82 0.18
83 0.17
84 0.21
85 0.21
86 0.22
87 0.19
88 0.21
89 0.24
90 0.2
91 0.19
92 0.17
93 0.17
94 0.17
95 0.16
96 0.15
97 0.14
98 0.14
99 0.14
100 0.13
101 0.14
102 0.14
103 0.16
104 0.17
105 0.15
106 0.16
107 0.15
108 0.14
109 0.15
110 0.14
111 0.12
112 0.1
113 0.09
114 0.09
115 0.09
116 0.09
117 0.07
118 0.1
119 0.1
120 0.17
121 0.19
122 0.2
123 0.2
124 0.21
125 0.2
126 0.2
127 0.21
128 0.15
129 0.16
130 0.15
131 0.15
132 0.15
133 0.16
134 0.14
135 0.13
136 0.12
137 0.09
138 0.09
139 0.1
140 0.1
141 0.11
142 0.12
143 0.13
144 0.15
145 0.15
146 0.18
147 0.17
148 0.18
149 0.18
150 0.17
151 0.18
152 0.16
153 0.19
154 0.17
155 0.18
156 0.15
157 0.14
158 0.13
159 0.12
160 0.15
161 0.11
162 0.11
163 0.1
164 0.14
165 0.15
166 0.14
167 0.15
168 0.14
169 0.16
170 0.15
171 0.18
172 0.15
173 0.15
174 0.15
175 0.15
176 0.12
177 0.11
178 0.12
179 0.1
180 0.1
181 0.11
182 0.14
183 0.15
184 0.16
185 0.19
186 0.2
187 0.19
188 0.21
189 0.21
190 0.18
191 0.18
192 0.19
193 0.16
194 0.15
195 0.14
196 0.12
197 0.12
198 0.12
199 0.13
200 0.12
201 0.14
202 0.13
203 0.15
204 0.16
205 0.21
206 0.21
207 0.26
208 0.28
209 0.27
210 0.28
211 0.28
212 0.27
213 0.25
214 0.24
215 0.2
216 0.23
217 0.29
218 0.33
219 0.4
220 0.49
221 0.57
222 0.68
223 0.76
224 0.82
225 0.85
226 0.89
227 0.92
228 0.91
229 0.91
230 0.84
231 0.83
232 0.75
233 0.66
234 0.59
235 0.56
236 0.52
237 0.44
238 0.45
239 0.42
240 0.49
241 0.53
242 0.57
243 0.5
244 0.55
245 0.61
246 0.64
247 0.67
248 0.68