Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3D5X2

Protein Details
Accession S3D5X2    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTFACKKCKKAFRKDADQYEESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 13.5, cyto 9
Family & Domain DBs
KEGG glz:GLAREA_06855  -  
Amino Acid Sequences MTFACKKCKKAFRKDADQYEESDEYCPHCDNHYVLEAVTAKPMLQVEGEDARVDSRMIKDERVRGEEQRTIFDVKEAPNKLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.85
4 0.76
5 0.67
6 0.62
7 0.53
8 0.42
9 0.34
10 0.25
11 0.19
12 0.2
13 0.19
14 0.13
15 0.14
16 0.15
17 0.15
18 0.16
19 0.16
20 0.14
21 0.13
22 0.15
23 0.15
24 0.13
25 0.13
26 0.1
27 0.08
28 0.08
29 0.09
30 0.06
31 0.05
32 0.05
33 0.07
34 0.09
35 0.09
36 0.08
37 0.08
38 0.08
39 0.09
40 0.09
41 0.08
42 0.08
43 0.14
44 0.16
45 0.2
46 0.24
47 0.29
48 0.34
49 0.38
50 0.39
51 0.38
52 0.42
53 0.43
54 0.4
55 0.38
56 0.36
57 0.33
58 0.3
59 0.28
60 0.26
61 0.26
62 0.34