FuNGI

S3DAI5

Protein Details

Accession

S3DAI5

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
100-127	VYAIPKPSPVRKQKPPPRKLAKDSEPQT	Hydrophilic

NLS Segment(s)

Position	Sequence
107-121	SPVRKQKPPPRKLAK

Subcellular Location(s)

plas 23, E.R. 4

Family & Domain DBs

InterPro	View protein in InterPro IPR009447 PIGW/GWT1
Gene Ontology	GO:0005789 C:endoplasmic reticulum membrane GO:0008374 F:O-acyltransferase activity GO:0006506 P:GPI anchor biosynthetic process
KEGG	glz:GLAREA_11171 -
Pfam	View protein in Pfam PF06423 GWT1

Amino Acid Sequences

MSRAAEAAMAASYKALKEDFVSNLTGGSISEINLVTAVSPVALVCWAALQSRLSFFKPYTPLAFAVDFLLNVGAILLAFTLYSDKPLLLSILLLAPVIMVYAIPKPSPVRKQKPPPRKLAKDSEPQTPLPKKPFLTIYRGAMMITTCIAILAVDFRIFPRRFAKVENWGTSLMDVGVGSFVFSAGIVAARPLLKEKLAGKTTPVLTRLSRSLRHSLPLLVLGFIRLYTVKGLDYAEHVTEYGVHWNFFFTLGFLPPFVAIFQSAFQIIPSYAALGIMLCSLYQIALEFTDLKAFVLTGPRDNLFSKNREGIFSFFGYLAIFLAGQSTGMIVIPRSLSKTLTSGAAQRKRLLLTLGAWCAVWISLFTITSSYNYGLNLTVSRRLANLPYFFWICAFNSCQITAFCLVETIFFPQAHQSTDAKTEAETYEASSSRVFEAYNRNGLAVFLAANLLTGLVNLTVPTLNVGEIEAMVILFAYASVVTGLAIGLDAYDISVKL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.11
2	0.11
3	0.1
4	0.13
5	0.17
6	0.2
7	0.21
8	0.22
9	0.2
10	0.2
11	0.2
12	0.17
13	0.13
14	0.12
15	0.1
16	0.09
17	0.12
18	0.11
19	0.11
20	0.11
21	0.11
22	0.08
23	0.08
24	0.08
25	0.05
26	0.05
27	0.05
28	0.05
29	0.05
30	0.05
31	0.04
32	0.06
33	0.06
34	0.07
35	0.09
36	0.11
37	0.12
38	0.17
39	0.2
40	0.21
41	0.24
42	0.24
43	0.3
44	0.32
45	0.34
46	0.33
47	0.33
48	0.32
49	0.33
50	0.32
51	0.25
52	0.24
53	0.2
54	0.16
55	0.13
56	0.12
57	0.08
58	0.08
59	0.07
60	0.04
61	0.03
62	0.03
63	0.03
64	0.03
65	0.03
66	0.03
67	0.06
68	0.06
69	0.08
70	0.09
71	0.09
72	0.09
73	0.1
74	0.11
75	0.08
76	0.08
77	0.07
78	0.08
79	0.08
80	0.07
81	0.06
82	0.05
83	0.05
84	0.05
85	0.04
86	0.03
87	0.04
88	0.07
89	0.08
90	0.08
91	0.11
92	0.15
93	0.23
94	0.33
95	0.42
96	0.49
97	0.58
98	0.7
99	0.78
100	0.86
101	0.87
102	0.88
103	0.88
104	0.88
105	0.86
106	0.85
107	0.82
108	0.81
109	0.76
110	0.73
111	0.66
112	0.59
113	0.6
114	0.56
115	0.54
116	0.49
117	0.51
118	0.44
119	0.44
120	0.5
121	0.45
122	0.46
123	0.45
124	0.42
125	0.38
126	0.37
127	0.33
128	0.26
129	0.22
130	0.15
131	0.11
132	0.08
133	0.05
134	0.05
135	0.05
136	0.04
137	0.04
138	0.05
139	0.05
140	0.05
141	0.05
142	0.07
143	0.16
144	0.16
145	0.19
146	0.23
147	0.26
148	0.27
149	0.32
150	0.36
151	0.38
152	0.45
153	0.45
154	0.42
155	0.38
156	0.37
157	0.33
158	0.28
159	0.17
160	0.1
161	0.07
162	0.05
163	0.04
164	0.04
165	0.04
166	0.03
167	0.03
168	0.03
169	0.03
170	0.03
171	0.03
172	0.03
173	0.03
174	0.03
175	0.05
176	0.05
177	0.05
178	0.08
179	0.09
180	0.09
181	0.12
182	0.15
183	0.21
184	0.23
185	0.23
186	0.22
187	0.26
188	0.29
189	0.28
190	0.27
191	0.22
192	0.21
193	0.23
194	0.27
195	0.26
196	0.27
197	0.29
198	0.33
199	0.32
200	0.33
201	0.31
202	0.27
203	0.24
204	0.22
205	0.18
206	0.13
207	0.12
208	0.1
209	0.09
210	0.07
211	0.07
212	0.05
213	0.05
214	0.05
215	0.06
216	0.05
217	0.06
218	0.07
219	0.07
220	0.08
221	0.09
222	0.09
223	0.08
224	0.08
225	0.07
226	0.07
227	0.08
228	0.11
229	0.1
230	0.1
231	0.1
232	0.1
233	0.11
234	0.11
235	0.1
236	0.05
237	0.06
238	0.06
239	0.07
240	0.06
241	0.06
242	0.06
243	0.06
244	0.05
245	0.05
246	0.04
247	0.05
248	0.05
249	0.05
250	0.06
251	0.05
252	0.05
253	0.06
254	0.06
255	0.06
256	0.05
257	0.05
258	0.05
259	0.05
260	0.05
261	0.04
262	0.04
263	0.03
264	0.03
265	0.03
266	0.03
267	0.03
268	0.03
269	0.03
270	0.03
271	0.03
272	0.03
273	0.04
274	0.05
275	0.05
276	0.06
277	0.06
278	0.06
279	0.06
280	0.06
281	0.06
282	0.11
283	0.11
284	0.12
285	0.14
286	0.14
287	0.16
288	0.18
289	0.22
290	0.21
291	0.24
292	0.25
293	0.29
294	0.29
295	0.29
296	0.29
297	0.26
298	0.24
299	0.22
300	0.2
301	0.14
302	0.14
303	0.12
304	0.11
305	0.09
306	0.06
307	0.05
308	0.04
309	0.04
310	0.04
311	0.04
312	0.04
313	0.03
314	0.03
315	0.04
316	0.04
317	0.04
318	0.05
319	0.06
320	0.07
321	0.09
322	0.1
323	0.11
324	0.12
325	0.13
326	0.13
327	0.15
328	0.15
329	0.2
330	0.28
331	0.34
332	0.35
333	0.36
334	0.37
335	0.36
336	0.36
337	0.31
338	0.23
339	0.2
340	0.22
341	0.21
342	0.19
343	0.18
344	0.16
345	0.15
346	0.13
347	0.1
348	0.05
349	0.05
350	0.06
351	0.07
352	0.07
353	0.08
354	0.08
355	0.1
356	0.11
357	0.11
358	0.11
359	0.11
360	0.11
361	0.11
362	0.11
363	0.13
364	0.13
365	0.17
366	0.17
367	0.17
368	0.17
369	0.19
370	0.22
371	0.25
372	0.25
373	0.22
374	0.25
375	0.26
376	0.25
377	0.23
378	0.22
379	0.17
380	0.19
381	0.2
382	0.19
383	0.2
384	0.2
385	0.21
386	0.2
387	0.21
388	0.2
389	0.18
390	0.14
391	0.13
392	0.13
393	0.12
394	0.13
395	0.14
396	0.15
397	0.14
398	0.15
399	0.19
400	0.21
401	0.21
402	0.24
403	0.22
404	0.21
405	0.26
406	0.26
407	0.22
408	0.2
409	0.21
410	0.18
411	0.18
412	0.16
413	0.14
414	0.17
415	0.17
416	0.18
417	0.16
418	0.17
419	0.17
420	0.17
421	0.15
422	0.15
423	0.24
424	0.28
425	0.34
426	0.33
427	0.32
428	0.31
429	0.31
430	0.27
431	0.18
432	0.13
433	0.07
434	0.07
435	0.06
436	0.06
437	0.06
438	0.06
439	0.05
440	0.05
441	0.05
442	0.05
443	0.05
444	0.05
445	0.06
446	0.06
447	0.06
448	0.08
449	0.08
450	0.08
451	0.08
452	0.08
453	0.08
454	0.07
455	0.08
456	0.06
457	0.05
458	0.05
459	0.04
460	0.04
461	0.03
462	0.03
463	0.03
464	0.03
465	0.04
466	0.04
467	0.04
468	0.04
469	0.05
470	0.04
471	0.04
472	0.04
473	0.04
474	0.03
475	0.04
476	0.03
477	0.04

S3DAI5

3D AlphaFold-predicted Structure Viewer