Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3D661

Protein Details
Accession S3D661    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
50-70RDATPEHYKKSRKDQKKSSRHBasic
NLS Segment(s)
PositionSequence
58-70KKSRKDQKKSSRH
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
KEGG glz:GLAREA_06970  -  
Amino Acid Sequences MSRGSNAERRDERLRVPDDDRKYITKTESGKNYIIDQRKPRYDVNEPLSRDATPEHYKKSRKDQKKSSRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.46
3 0.49
4 0.51
5 0.5
6 0.52
7 0.51
8 0.45
9 0.44
10 0.42
11 0.37
12 0.35
13 0.34
14 0.34
15 0.37
16 0.38
17 0.36
18 0.35
19 0.36
20 0.36
21 0.37
22 0.36
23 0.37
24 0.39
25 0.41
26 0.43
27 0.42
28 0.42
29 0.43
30 0.46
31 0.46
32 0.47
33 0.45
34 0.45
35 0.45
36 0.39
37 0.33
38 0.27
39 0.27
40 0.27
41 0.3
42 0.34
43 0.41
44 0.48
45 0.54
46 0.64
47 0.68
48 0.71
49 0.78
50 0.82