Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3DLT1

Protein Details
Accession S3DLT1   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPSPRQRPRRAPRSRNPLPDSQPHydrophilic
238-263TRTAWKLAMRKVKRAKRRPAGNRRRPBasic
NLS Segment(s)
PositionSequence
9-10RR
245-263AMRKVKRAKRRPAGNRRRP
Subcellular Location(s) plas 10, nucl 6, mito 6, mito_nucl 6
Family & Domain DBs
KEGG glz:GLAREA_04284  -  
Amino Acid Sequences MPSPRQRPRRAPRSRNPLPDSQPANNHPPIPGSYIHDFDFASAPLHRPFRNGEIIDLTDSSSNLNSPPDLSNLLTSTSHLITQTATLAATYGLQKLNEQNLPSHVSDFILASTQRAANVDWLRVSQDVLAWVQTHPQEAKVAGYVVAGGAVFFKPRLLPKLAWEAWKIKSGGLGAREFSYLVRLRVGSADDAVVNPFSGLTAGVGLATSAAAAVIAGIGGGVEDEGEGEDESDFAVLTRTAWKLAMRKVKRAKRRPAGNRRRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.86
4 0.85
5 0.8
6 0.78
7 0.74
8 0.69
9 0.67
10 0.61
11 0.63
12 0.57
13 0.52
14 0.43
15 0.39
16 0.35
17 0.31
18 0.28
19 0.26
20 0.26
21 0.28
22 0.28
23 0.26
24 0.24
25 0.22
26 0.22
27 0.16
28 0.15
29 0.13
30 0.15
31 0.19
32 0.24
33 0.23
34 0.24
35 0.27
36 0.3
37 0.37
38 0.35
39 0.32
40 0.31
41 0.32
42 0.31
43 0.27
44 0.23
45 0.15
46 0.15
47 0.13
48 0.1
49 0.09
50 0.08
51 0.09
52 0.08
53 0.1
54 0.11
55 0.12
56 0.14
57 0.14
58 0.15
59 0.14
60 0.16
61 0.14
62 0.14
63 0.14
64 0.13
65 0.13
66 0.11
67 0.11
68 0.09
69 0.1
70 0.1
71 0.07
72 0.07
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.08
79 0.09
80 0.09
81 0.1
82 0.13
83 0.17
84 0.18
85 0.18
86 0.17
87 0.19
88 0.22
89 0.22
90 0.2
91 0.16
92 0.14
93 0.13
94 0.12
95 0.1
96 0.08
97 0.08
98 0.07
99 0.08
100 0.08
101 0.08
102 0.09
103 0.09
104 0.13
105 0.14
106 0.15
107 0.14
108 0.14
109 0.14
110 0.14
111 0.14
112 0.08
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.09
120 0.09
121 0.1
122 0.09
123 0.1
124 0.1
125 0.09
126 0.1
127 0.08
128 0.08
129 0.07
130 0.06
131 0.06
132 0.04
133 0.04
134 0.04
135 0.03
136 0.03
137 0.03
138 0.04
139 0.04
140 0.04
141 0.06
142 0.08
143 0.12
144 0.15
145 0.15
146 0.19
147 0.28
148 0.3
149 0.31
150 0.32
151 0.32
152 0.3
153 0.34
154 0.31
155 0.22
156 0.22
157 0.2
158 0.21
159 0.2
160 0.19
161 0.16
162 0.16
163 0.16
164 0.15
165 0.13
166 0.16
167 0.15
168 0.14
169 0.15
170 0.14
171 0.15
172 0.16
173 0.17
174 0.12
175 0.11
176 0.11
177 0.09
178 0.1
179 0.1
180 0.09
181 0.07
182 0.06
183 0.05
184 0.05
185 0.05
186 0.05
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.03
195 0.03
196 0.02
197 0.02
198 0.02
199 0.02
200 0.02
201 0.02
202 0.02
203 0.02
204 0.02
205 0.02
206 0.02
207 0.02
208 0.02
209 0.02
210 0.02
211 0.02
212 0.03
213 0.04
214 0.04
215 0.05
216 0.05
217 0.05
218 0.05
219 0.05
220 0.05
221 0.04
222 0.05
223 0.05
224 0.06
225 0.11
226 0.12
227 0.13
228 0.15
229 0.19
230 0.25
231 0.33
232 0.43
233 0.44
234 0.53
235 0.63
236 0.71
237 0.78
238 0.82
239 0.85
240 0.84
241 0.91
242 0.92
243 0.92