Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CY73

Protein Details
Accession S3CY73   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
71-90DIEQQKLRDKPTRRRRSSARBasic
NLS Segment(s)
PositionSequence
78-90RDKPTRRRRSSAR
Subcellular Location(s) nucl 8cyto 8cyto_nucl 8, cysk 6, cyto_pero 6
Family & Domain DBs
KEGG glz:GLAREA_01059  -  
Amino Acid Sequences MSLPMEWQTTTHPNAYDIERSAVITVLIPNLLENIVGKWLWDTFGETAFYEADNDRGAGYWKVTAPRRITDIEQQKLRDKPTRRRRSSAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.27
4 0.23
5 0.23
6 0.2
7 0.2
8 0.19
9 0.16
10 0.13
11 0.1
12 0.09
13 0.07
14 0.07
15 0.06
16 0.06
17 0.06
18 0.06
19 0.05
20 0.05
21 0.05
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.07
28 0.06
29 0.08
30 0.07
31 0.08
32 0.09
33 0.08
34 0.09
35 0.09
36 0.08
37 0.08
38 0.07
39 0.07
40 0.07
41 0.07
42 0.06
43 0.06
44 0.08
45 0.08
46 0.08
47 0.1
48 0.11
49 0.17
50 0.21
51 0.27
52 0.29
53 0.31
54 0.34
55 0.35
56 0.37
57 0.4
58 0.46
59 0.47
60 0.49
61 0.5
62 0.54
63 0.55
64 0.58
65 0.57
66 0.57
67 0.61
68 0.67
69 0.75
70 0.76