Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CCX2

Protein Details
Accession S3CCX2   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
63-85LLAQKAFARRNKRRSNVEGKGPGHydrophilic
NLS Segment(s)
PositionSequence
73-76NKRR
Subcellular Location(s) cyto_nucl 10, cyto 9.5, nucl 7.5, mito 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG glz:GLAREA_08234  -  
Amino Acid Sequences MSFTTKSKRESQVAPPPESYEEQLTTTHNGTHIASSKSHKAELEFAAIAVVIGLVVFVVVLGLLAQKAFARRNKRRSNVEGKGPGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.55
3 0.5
4 0.48
5 0.44
6 0.37
7 0.3
8 0.24
9 0.22
10 0.21
11 0.2
12 0.2
13 0.18
14 0.17
15 0.14
16 0.14
17 0.13
18 0.14
19 0.16
20 0.15
21 0.17
22 0.19
23 0.24
24 0.24
25 0.24
26 0.22
27 0.2
28 0.22
29 0.2
30 0.2
31 0.15
32 0.13
33 0.12
34 0.11
35 0.1
36 0.06
37 0.05
38 0.02
39 0.02
40 0.02
41 0.01
42 0.01
43 0.01
44 0.01
45 0.01
46 0.01
47 0.01
48 0.02
49 0.02
50 0.02
51 0.02
52 0.03
53 0.04
54 0.08
55 0.14
56 0.21
57 0.32
58 0.42
59 0.53
60 0.63
61 0.71
62 0.77
63 0.81
64 0.85
65 0.82
66 0.83