Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3CCY0

Protein Details
Accession S3CCY0    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
44-68QALRKVNKVYKKRKEDQSPEKKVIAHydrophilic
NLS Segment(s)
PositionSequence
36-65KKKAAKMSQALRKVNKVYKKRKEDQSPEKK
74-81KPIRRTKK
Subcellular Location(s) nucl 21, mito_nucl 14.166, cyto_nucl 12.166
Family & Domain DBs
KEGG glz:GLAREA_08244  -  
Amino Acid Sequences MTIATIKNRSSESTVILKKNSTNDGGKNYTLAALDKKKAAKMSQALRKVNKVYKKRKEDQSPEKKVIAWFNTTKPIRRTKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.38
4 0.37
5 0.35
6 0.38
7 0.37
8 0.32
9 0.3
10 0.3
11 0.35
12 0.36
13 0.33
14 0.29
15 0.26
16 0.23
17 0.19
18 0.17
19 0.16
20 0.16
21 0.17
22 0.19
23 0.2
24 0.21
25 0.23
26 0.23
27 0.23
28 0.26
29 0.32
30 0.37
31 0.44
32 0.47
33 0.47
34 0.51
35 0.51
36 0.51
37 0.52
38 0.54
39 0.58
40 0.63
41 0.7
42 0.75
43 0.8
44 0.84
45 0.85
46 0.87
47 0.87
48 0.85
49 0.81
50 0.73
51 0.66
52 0.59
53 0.56
54 0.48
55 0.44
56 0.38
57 0.38
58 0.46
59 0.47
60 0.51
61 0.5