Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3D0K0

Protein Details
Accession S3D0K0    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
92-138AAAPEEKSPDKKRKRATKKSTEVAEEQVETPKSQPKNSRKKKAKADAHydrophilic
NLS Segment(s)
PositionSequence
55-70PKTPKAKPTRKGKATK
94-111APEEKSPDKKRKRATKKS
123-136KSQPKNSRKKKAKA
Subcellular Location(s) nucl 16, cyto_nucl 12.333, mito_nucl 9.833, cyto 7.5
Family & Domain DBs
KEGG glz:GLAREA_03656  -  
Amino Acid Sequences MTDQEAATYAELHEVGADTTADAQLVGEASATALHDEDAEGEPEKEPTPPPVALPKTPKAKPTRKGKATKETPAAAGSDAIVPPSSIVPAKAAAPEEKSPDKKRKRATKKSTEVAEEQVETPKSQPKNSRKKKAKADA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.07
5 0.06
6 0.07
7 0.07
8 0.06
9 0.06
10 0.05
11 0.05
12 0.05
13 0.05
14 0.04
15 0.04
16 0.04
17 0.04
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.07
25 0.07
26 0.08
27 0.09
28 0.09
29 0.1
30 0.11
31 0.11
32 0.11
33 0.1
34 0.12
35 0.15
36 0.15
37 0.16
38 0.23
39 0.25
40 0.28
41 0.33
42 0.37
43 0.41
44 0.42
45 0.48
46 0.49
47 0.55
48 0.59
49 0.64
50 0.68
51 0.69
52 0.76
53 0.76
54 0.77
55 0.75
56 0.72
57 0.65
58 0.56
59 0.48
60 0.4
61 0.33
62 0.23
63 0.17
64 0.12
65 0.08
66 0.07
67 0.07
68 0.06
69 0.05
70 0.05
71 0.05
72 0.06
73 0.05
74 0.06
75 0.06
76 0.07
77 0.08
78 0.09
79 0.1
80 0.11
81 0.15
82 0.16
83 0.21
84 0.27
85 0.33
86 0.39
87 0.48
88 0.57
89 0.61
90 0.69
91 0.75
92 0.8
93 0.85
94 0.88
95 0.89
96 0.89
97 0.89
98 0.84
99 0.78
100 0.69
101 0.62
102 0.54
103 0.44
104 0.36
105 0.33
106 0.29
107 0.25
108 0.24
109 0.27
110 0.28
111 0.33
112 0.43
113 0.48
114 0.59
115 0.69
116 0.78
117 0.81
118 0.88