Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3DKK1

Protein Details
Accession S3DKK1    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-42KGASAPSGIKKKKKKSKPTVNEEGLSHydrophilic
NLS Segment(s)
PositionSequence
15-33KLKGASAPSGIKKKKKKSK
87-102RRKRLERRLEKEGPKT
Subcellular Location(s) nucl 18.5, cyto_nucl 12.333, mito_nucl 12.166, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
KEGG glz:GLAREA_07715  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSDDYTPIVRGGLKLKGASAPSGIKKKKKKSKPTVNEEGLSKAIDSDAGSSKKAAAQEEEGLDLRELEPKDFDGKTATERAYEETRRKRLERRLEKEGPKTHKQRVEGLNTYLSTLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.21
4 0.23
5 0.24
6 0.23
7 0.22
8 0.23
9 0.27
10 0.37
11 0.43
12 0.48
13 0.57
14 0.67
15 0.74
16 0.79
17 0.84
18 0.85
19 0.9
20 0.92
21 0.91
22 0.91
23 0.85
24 0.77
25 0.67
26 0.58
27 0.48
28 0.37
29 0.27
30 0.17
31 0.12
32 0.09
33 0.08
34 0.08
35 0.12
36 0.13
37 0.13
38 0.13
39 0.14
40 0.15
41 0.17
42 0.15
43 0.11
44 0.12
45 0.14
46 0.14
47 0.15
48 0.14
49 0.12
50 0.12
51 0.1
52 0.08
53 0.11
54 0.1
55 0.09
56 0.09
57 0.1
58 0.13
59 0.13
60 0.13
61 0.11
62 0.12
63 0.14
64 0.17
65 0.16
66 0.14
67 0.15
68 0.18
69 0.22
70 0.27
71 0.33
72 0.39
73 0.46
74 0.5
75 0.53
76 0.58
77 0.62
78 0.68
79 0.7
80 0.69
81 0.71
82 0.75
83 0.78
84 0.79
85 0.78
86 0.75
87 0.73
88 0.73
89 0.72
90 0.69
91 0.65
92 0.65
93 0.64
94 0.65
95 0.6
96 0.55
97 0.51
98 0.45
99 0.44
100 0.35
101 0.28
102 0.2
103 0.17
104 0.17
105 0.15
106 0.16
107 0.17
108 0.23
109 0.23