Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3DGG4

Protein Details
Accession S3DGG4    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
101-136REPPVSHRRERTPRRRSSERKREKDRRDRDRPVVPPBasic
NLS Segment(s)
PositionSequence
93-138GRERKVRVREPPVSHRRERTPRRRSSERKREKDRRDRDRPVVPPPP
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
KEGG glz:GLAREA_04088  -  
Amino Acid Sequences MLTSRRKESHAQLIHRINERAAYYYNARPHPSEILAADADLKRGIDEDWKASVQRYPEVLEYFYGLVDLNLPSDDDPGVRDPPLSALGGGASGRERKVRVREPPVSHRRERTPRRRSSERKREKDRRDRDRPVVPPPPPIRVPSRGAGYSGGGYSYGPIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.65
3 0.59
4 0.49
5 0.45
6 0.41
7 0.34
8 0.29
9 0.27
10 0.26
11 0.3
12 0.37
13 0.36
14 0.38
15 0.36
16 0.38
17 0.38
18 0.34
19 0.3
20 0.24
21 0.23
22 0.2
23 0.18
24 0.19
25 0.15
26 0.14
27 0.12
28 0.12
29 0.09
30 0.09
31 0.1
32 0.11
33 0.12
34 0.14
35 0.16
36 0.17
37 0.18
38 0.18
39 0.2
40 0.17
41 0.18
42 0.16
43 0.16
44 0.17
45 0.18
46 0.18
47 0.16
48 0.15
49 0.13
50 0.11
51 0.09
52 0.07
53 0.05
54 0.06
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.06
62 0.05
63 0.06
64 0.07
65 0.08
66 0.08
67 0.08
68 0.08
69 0.09
70 0.1
71 0.09
72 0.07
73 0.06
74 0.06
75 0.06
76 0.06
77 0.05
78 0.05
79 0.06
80 0.07
81 0.09
82 0.1
83 0.15
84 0.23
85 0.3
86 0.37
87 0.44
88 0.52
89 0.56
90 0.66
91 0.71
92 0.7
93 0.68
94 0.65
95 0.66
96 0.69
97 0.73
98 0.74
99 0.75
100 0.78
101 0.82
102 0.87
103 0.88
104 0.88
105 0.89
106 0.89
107 0.89
108 0.91
109 0.92
110 0.93
111 0.93
112 0.93
113 0.92
114 0.91
115 0.9
116 0.87
117 0.86
118 0.79
119 0.77
120 0.76
121 0.67
122 0.66
123 0.61
124 0.59
125 0.52
126 0.52
127 0.49
128 0.45
129 0.48
130 0.43
131 0.45
132 0.4
133 0.39
134 0.36
135 0.32
136 0.28
137 0.24
138 0.19
139 0.13
140 0.12