Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CYZ4

Protein Details
Accession S3CYZ4   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
162-183SDPGFRRTDPRKVNKTKITLHSHydrophilic
NLS Segment(s)
PositionSequence
51-75REEERKRGRGEERRGENKKRGRGSR
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
KEGG glz:GLAREA_12258  -  
Amino Acid Sequences MPYVISLSTKYPDNCSATREGHDPSSVDPRNISNGGYTGLSKYSEFKQGGREEERKRGRGEERRGENKKRGRGSRTYKHLEQLRTDTADTAQLVKSLGNGLGLRHTVVVEYAESKSILEHSRGEQGDFELRRVYLLEMNDGIRYFVNLNGKGGCWKLVESVSDPGFRRTDPRKVNKTKITLHSVPRSRDAPETVCRMKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.41
4 0.38
5 0.4
6 0.38
7 0.34
8 0.31
9 0.32
10 0.28
11 0.25
12 0.33
13 0.32
14 0.29
15 0.28
16 0.27
17 0.31
18 0.31
19 0.28
20 0.19
21 0.18
22 0.18
23 0.18
24 0.16
25 0.12
26 0.13
27 0.13
28 0.13
29 0.15
30 0.16
31 0.22
32 0.23
33 0.23
34 0.29
35 0.32
36 0.38
37 0.42
38 0.48
39 0.45
40 0.54
41 0.6
42 0.56
43 0.54
44 0.54
45 0.57
46 0.58
47 0.63
48 0.62
49 0.64
50 0.71
51 0.76
52 0.76
53 0.76
54 0.74
55 0.73
56 0.72
57 0.69
58 0.65
59 0.68
60 0.71
61 0.71
62 0.72
63 0.7
64 0.64
65 0.64
66 0.64
67 0.57
68 0.5
69 0.46
70 0.4
71 0.35
72 0.33
73 0.26
74 0.21
75 0.19
76 0.16
77 0.13
78 0.1
79 0.09
80 0.09
81 0.08
82 0.08
83 0.07
84 0.07
85 0.06
86 0.06
87 0.06
88 0.07
89 0.07
90 0.07
91 0.07
92 0.07
93 0.05
94 0.05
95 0.06
96 0.05
97 0.06
98 0.06
99 0.07
100 0.07
101 0.07
102 0.07
103 0.09
104 0.1
105 0.1
106 0.11
107 0.12
108 0.19
109 0.19
110 0.2
111 0.17
112 0.17
113 0.23
114 0.22
115 0.21
116 0.16
117 0.15
118 0.15
119 0.15
120 0.15
121 0.12
122 0.12
123 0.13
124 0.13
125 0.14
126 0.14
127 0.13
128 0.13
129 0.09
130 0.1
131 0.09
132 0.11
133 0.17
134 0.17
135 0.18
136 0.18
137 0.19
138 0.2
139 0.2
140 0.19
141 0.13
142 0.13
143 0.14
144 0.15
145 0.17
146 0.17
147 0.22
148 0.22
149 0.26
150 0.27
151 0.28
152 0.27
153 0.26
154 0.31
155 0.32
156 0.4
157 0.45
158 0.55
159 0.62
160 0.7
161 0.8
162 0.8
163 0.82
164 0.81
165 0.78
166 0.77
167 0.72
168 0.71
169 0.72
170 0.7
171 0.67
172 0.64
173 0.58
174 0.52
175 0.51
176 0.47
177 0.42
178 0.41
179 0.46
180 0.45