Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3D043

Protein Details
Accession S3D043   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-33PRSNSPNSKRLRREWERQVCRKLRDLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito_nucl 12.166, mito 10.5, cyto_nucl 9.333
Family & Domain DBs
KEGG glz:GLAREA_04182  -  
Amino Acid Sequences MSTLRVTPRSNSPNSKRLRREWERQVCRKLRDLHQPTWGFTIFRTVYTPESDAQFPLFLAKLRTYVDNAIDWDLRPTPYTALSTEPPFDHGPNEEMKRRFVNDVVEDRDLDGANTDAVRDAFTKWLKGEGVDLDMHQLYARHRVCIMVDESVMNSVTAAPEDPNEDYELDSVWVKVVEYLAPGECEWQAWLKVGLNAIENFWFNVFANEEAEDMFTAMMEDGEKAWTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.77
3 0.75
4 0.76
5 0.79
6 0.77
7 0.8
8 0.82
9 0.85
10 0.85
11 0.87
12 0.88
13 0.85
14 0.81
15 0.8
16 0.76
17 0.73
18 0.73
19 0.71
20 0.65
21 0.67
22 0.65
23 0.58
24 0.55
25 0.48
26 0.37
27 0.3
28 0.33
29 0.24
30 0.23
31 0.23
32 0.2
33 0.21
34 0.24
35 0.25
36 0.18
37 0.2
38 0.2
39 0.19
40 0.17
41 0.16
42 0.13
43 0.13
44 0.12
45 0.1
46 0.12
47 0.12
48 0.13
49 0.14
50 0.16
51 0.16
52 0.18
53 0.18
54 0.17
55 0.18
56 0.18
57 0.17
58 0.16
59 0.16
60 0.15
61 0.14
62 0.13
63 0.13
64 0.12
65 0.13
66 0.14
67 0.13
68 0.14
69 0.16
70 0.16
71 0.17
72 0.16
73 0.18
74 0.18
75 0.17
76 0.15
77 0.14
78 0.15
79 0.18
80 0.21
81 0.24
82 0.24
83 0.26
84 0.27
85 0.28
86 0.27
87 0.24
88 0.25
89 0.23
90 0.26
91 0.27
92 0.26
93 0.24
94 0.23
95 0.22
96 0.18
97 0.13
98 0.09
99 0.06
100 0.05
101 0.05
102 0.05
103 0.04
104 0.04
105 0.05
106 0.06
107 0.06
108 0.11
109 0.11
110 0.13
111 0.12
112 0.14
113 0.14
114 0.13
115 0.14
116 0.1
117 0.11
118 0.1
119 0.1
120 0.1
121 0.1
122 0.09
123 0.08
124 0.09
125 0.08
126 0.17
127 0.17
128 0.16
129 0.17
130 0.17
131 0.18
132 0.2
133 0.2
134 0.12
135 0.12
136 0.11
137 0.11
138 0.12
139 0.12
140 0.08
141 0.06
142 0.05
143 0.05
144 0.05
145 0.06
146 0.05
147 0.06
148 0.08
149 0.09
150 0.09
151 0.11
152 0.11
153 0.11
154 0.11
155 0.11
156 0.1
157 0.09
158 0.08
159 0.07
160 0.07
161 0.07
162 0.07
163 0.07
164 0.07
165 0.07
166 0.09
167 0.09
168 0.1
169 0.1
170 0.11
171 0.1
172 0.1
173 0.1
174 0.11
175 0.12
176 0.12
177 0.14
178 0.14
179 0.16
180 0.17
181 0.17
182 0.18
183 0.18
184 0.17
185 0.17
186 0.16
187 0.15
188 0.14
189 0.14
190 0.11
191 0.13
192 0.14
193 0.13
194 0.14
195 0.14
196 0.13
197 0.12
198 0.13
199 0.11
200 0.09
201 0.08
202 0.06
203 0.06
204 0.06
205 0.06
206 0.06
207 0.06
208 0.06