Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CDR4

Protein Details
Accession S3CDR4   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
235-266LPRGRPKLPESQKKAKPEPKPKKEKAEPTGLPBasic
327-347SAKRKADDEKPGRGRPKKVKTBasic
NLS Segment(s)
PositionSequence
205-347PKPKKEPSGLPRGRPKMAEHEKKPKKESSGLPRGRPKLPESQKKAKPEPKPKKEKAEPTGLPRGRPRKSDAESVVATPKRGRPSVNKAGVAPPASASKATPGSTGKGRGRPKKVVDEVATPASAKRKADDEKPGRGRPKKVKT
Subcellular Location(s) nucl 22.5, cyto_nucl 14.333, mito_nucl 12.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
KEGG glz:GLAREA_08515  -  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MADSISIEEFEAALDRYEDVLEVKARSVKGETSLEELDQFRYVEAPAQFSKKTGRLMDLKDIQKLLEWKLRHGKFRPSLPKQVASNSDEKVHEACKDGFDHYAAHPDDIQAVIKKLTAPLKGIGPATASLLLAVHDPANVIFFSDEVYAWLVGKGKSSGISYTAKEFEQIFTASTALAKRLDVSPIDIEKVAYAIIRENEPVHTPKPKKEPSGLPRGRPKMAEHEKKPKKESSGLPRGRPKLPESQKKAKPEPKPKKEKAEPTGLPRGRPRKSDAESVVATPKRGRPSVNKAGVAPPASASKATPGSTGKGRGRPKKVVDEVATPASAKRKADDEKPGRGRPKKVKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.1
5 0.1
6 0.09
7 0.12
8 0.14
9 0.15
10 0.16
11 0.2
12 0.2
13 0.22
14 0.23
15 0.22
16 0.25
17 0.28
18 0.27
19 0.28
20 0.29
21 0.27
22 0.28
23 0.27
24 0.23
25 0.21
26 0.2
27 0.14
28 0.14
29 0.14
30 0.17
31 0.17
32 0.2
33 0.21
34 0.25
35 0.26
36 0.27
37 0.33
38 0.31
39 0.36
40 0.34
41 0.37
42 0.39
43 0.44
44 0.51
45 0.53
46 0.51
47 0.49
48 0.47
49 0.41
50 0.37
51 0.36
52 0.32
53 0.3
54 0.28
55 0.32
56 0.42
57 0.46
58 0.5
59 0.52
60 0.57
61 0.57
62 0.67
63 0.7
64 0.67
65 0.72
66 0.7
67 0.71
68 0.63
69 0.62
70 0.58
71 0.51
72 0.49
73 0.4
74 0.39
75 0.33
76 0.32
77 0.28
78 0.24
79 0.21
80 0.21
81 0.21
82 0.19
83 0.2
84 0.2
85 0.19
86 0.18
87 0.19
88 0.15
89 0.22
90 0.2
91 0.19
92 0.18
93 0.17
94 0.17
95 0.15
96 0.16
97 0.1
98 0.1
99 0.1
100 0.1
101 0.11
102 0.14
103 0.17
104 0.17
105 0.18
106 0.18
107 0.2
108 0.21
109 0.21
110 0.18
111 0.14
112 0.13
113 0.12
114 0.11
115 0.09
116 0.07
117 0.07
118 0.07
119 0.06
120 0.06
121 0.05
122 0.04
123 0.05
124 0.05
125 0.06
126 0.05
127 0.05
128 0.05
129 0.04
130 0.05
131 0.06
132 0.06
133 0.05
134 0.06
135 0.06
136 0.06
137 0.07
138 0.08
139 0.08
140 0.09
141 0.09
142 0.08
143 0.09
144 0.1
145 0.09
146 0.11
147 0.13
148 0.13
149 0.15
150 0.16
151 0.15
152 0.16
153 0.16
154 0.13
155 0.12
156 0.12
157 0.1
158 0.09
159 0.09
160 0.07
161 0.08
162 0.08
163 0.07
164 0.07
165 0.07
166 0.07
167 0.08
168 0.09
169 0.08
170 0.1
171 0.12
172 0.12
173 0.13
174 0.12
175 0.11
176 0.09
177 0.09
178 0.08
179 0.05
180 0.05
181 0.06
182 0.07
183 0.07
184 0.08
185 0.09
186 0.1
187 0.12
188 0.15
189 0.15
190 0.23
191 0.26
192 0.31
193 0.4
194 0.45
195 0.46
196 0.5
197 0.57
198 0.55
199 0.64
200 0.62
201 0.59
202 0.63
203 0.64
204 0.59
205 0.51
206 0.47
207 0.47
208 0.53
209 0.56
210 0.53
211 0.6
212 0.66
213 0.71
214 0.74
215 0.68
216 0.62
217 0.6
218 0.62
219 0.61
220 0.64
221 0.64
222 0.66
223 0.69
224 0.69
225 0.65
226 0.6
227 0.53
228 0.53
229 0.57
230 0.6
231 0.6
232 0.66
233 0.69
234 0.74
235 0.8
236 0.78
237 0.78
238 0.79
239 0.82
240 0.83
241 0.87
242 0.86
243 0.87
244 0.88
245 0.88
246 0.82
247 0.81
248 0.75
249 0.71
250 0.74
251 0.65
252 0.6
253 0.59
254 0.62
255 0.56
256 0.56
257 0.55
258 0.54
259 0.56
260 0.61
261 0.55
262 0.52
263 0.48
264 0.47
265 0.49
266 0.4
267 0.37
268 0.32
269 0.34
270 0.34
271 0.35
272 0.38
273 0.39
274 0.48
275 0.57
276 0.61
277 0.58
278 0.53
279 0.55
280 0.55
281 0.47
282 0.38
283 0.29
284 0.24
285 0.23
286 0.21
287 0.18
288 0.18
289 0.2
290 0.21
291 0.23
292 0.22
293 0.25
294 0.3
295 0.38
296 0.39
297 0.44
298 0.54
299 0.6
300 0.66
301 0.71
302 0.73
303 0.75
304 0.75
305 0.75
306 0.69
307 0.64
308 0.61
309 0.55
310 0.48
311 0.38
312 0.34
313 0.32
314 0.32
315 0.28
316 0.26
317 0.31
318 0.36
319 0.44
320 0.52
321 0.53
322 0.6
323 0.68
324 0.74
325 0.77
326 0.79
327 0.81