Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CDM8

Protein Details
Accession S3CDM8   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
113-141ANIPKRSLLRNEKEERKKRQRTMIVIDSSHydrophilic
NLS Segment(s)
PositionSequence
128-130RKK
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
KEGG glz:GLAREA_08480  -  
Amino Acid Sequences MTFKFMKDGDWKWPIKDCDTKAVFRSLIERRRHLMSKTLAGHNRSEEQALEFVPKSKSETTRSANREMNKKAEAAASHMARETSSHDVRATDKDSMTGSMSEEQPSAMSAISANIPKRSLLRNEKEERKKRQRTMIVIDSSDDEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.54
4 0.48
5 0.49
6 0.52
7 0.52
8 0.47
9 0.49
10 0.42
11 0.34
12 0.39
13 0.37
14 0.42
15 0.44
16 0.46
17 0.44
18 0.5
19 0.53
20 0.47
21 0.47
22 0.43
23 0.44
24 0.45
25 0.5
26 0.48
27 0.46
28 0.46
29 0.41
30 0.39
31 0.32
32 0.28
33 0.21
34 0.17
35 0.16
36 0.15
37 0.14
38 0.12
39 0.13
40 0.14
41 0.14
42 0.16
43 0.18
44 0.22
45 0.24
46 0.31
47 0.33
48 0.41
49 0.44
50 0.47
51 0.47
52 0.47
53 0.5
54 0.46
55 0.45
56 0.37
57 0.34
58 0.29
59 0.26
60 0.22
61 0.18
62 0.2
63 0.16
64 0.16
65 0.16
66 0.15
67 0.13
68 0.14
69 0.13
70 0.15
71 0.15
72 0.16
73 0.16
74 0.17
75 0.19
76 0.22
77 0.21
78 0.17
79 0.17
80 0.17
81 0.17
82 0.17
83 0.17
84 0.13
85 0.12
86 0.13
87 0.14
88 0.14
89 0.13
90 0.12
91 0.11
92 0.11
93 0.1
94 0.06
95 0.06
96 0.05
97 0.06
98 0.08
99 0.12
100 0.13
101 0.14
102 0.15
103 0.16
104 0.2
105 0.24
106 0.31
107 0.38
108 0.45
109 0.53
110 0.62
111 0.71
112 0.79
113 0.83
114 0.85
115 0.86
116 0.88
117 0.86
118 0.88
119 0.86
120 0.84
121 0.83
122 0.81
123 0.76
124 0.66
125 0.59