Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CXI0

Protein Details
Accession S3CXI0    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
50-70HGRAHRHQRLTKTKRPPEIKTBasic
NLS Segment(s)
Subcellular Location(s) cyto 8cyto_nucl 8, nucl 6, pero 6, mito 3, cysk 3
Family & Domain DBs
KEGG glz:GLAREA_13018  -  
Amino Acid Sequences MHTNSEIDWSNIFATWTDAFGGLDIDGIFERILANEDEAGTDVTSANNTHGRAHRHQRLTKTKRPPEIKTAQAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.11
5 0.1
6 0.1
7 0.09
8 0.1
9 0.06
10 0.06
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.04
19 0.06
20 0.05
21 0.06
22 0.05
23 0.06
24 0.06
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.06
33 0.07
34 0.1
35 0.11
36 0.15
37 0.19
38 0.25
39 0.32
40 0.42
41 0.49
42 0.55
43 0.6
44 0.66
45 0.73
46 0.76
47 0.78
48 0.79
49 0.79
50 0.8
51 0.83
52 0.79
53 0.77
54 0.77