Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0E143

Protein Details
Accession B0E143    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
170-192DEINIKKKSKKVLKPKSSIKLGLHydrophilic
NLS Segment(s)
PositionSequence
138-149RGKDKKAEQPKK
175-185KKKSKKVLKPK
Subcellular Location(s) mito 12, nucl 9, cyto 4
Family & Domain DBs
KEGG lbc:LACBIDRAFT_316535  -  
Amino Acid Sequences MTDYAAQGKTRPYNVVHLNSCHTHMSYYTCLSRSASAAGTIILQGFEPSIVTRGCAKYLRQELREQELLDEITRLRYEGSLPPCVVGYTRNSLIRNFQNWKGTAYVPEKTDASLSWSESDPMDILPVVTDSPWQIIKRGKDKKAEQPKKASTFVPAKGSVAVKHKLDDDDEINIKKKSKKVLKPKSSIKLGLQWDSINYSCAYDSLFVILYHIWNIDPLRWTTNFTEINQDYLGALATSVTQCQLTISHANST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.51
3 0.49
4 0.46
5 0.49
6 0.47
7 0.47
8 0.41
9 0.33
10 0.27
11 0.24
12 0.26
13 0.24
14 0.27
15 0.28
16 0.26
17 0.27
18 0.28
19 0.28
20 0.24
21 0.23
22 0.19
23 0.16
24 0.15
25 0.14
26 0.13
27 0.11
28 0.1
29 0.07
30 0.07
31 0.06
32 0.06
33 0.05
34 0.05
35 0.06
36 0.08
37 0.08
38 0.09
39 0.14
40 0.15
41 0.18
42 0.21
43 0.22
44 0.28
45 0.38
46 0.44
47 0.42
48 0.47
49 0.48
50 0.52
51 0.54
52 0.45
53 0.36
54 0.31
55 0.29
56 0.23
57 0.19
58 0.13
59 0.12
60 0.11
61 0.11
62 0.09
63 0.09
64 0.11
65 0.16
66 0.2
67 0.22
68 0.22
69 0.22
70 0.21
71 0.21
72 0.19
73 0.14
74 0.14
75 0.15
76 0.17
77 0.21
78 0.22
79 0.23
80 0.28
81 0.31
82 0.34
83 0.34
84 0.35
85 0.36
86 0.36
87 0.37
88 0.33
89 0.29
90 0.29
91 0.28
92 0.27
93 0.22
94 0.23
95 0.21
96 0.19
97 0.19
98 0.13
99 0.14
100 0.12
101 0.12
102 0.12
103 0.12
104 0.13
105 0.12
106 0.12
107 0.08
108 0.07
109 0.06
110 0.05
111 0.04
112 0.04
113 0.04
114 0.04
115 0.03
116 0.04
117 0.04
118 0.05
119 0.08
120 0.08
121 0.11
122 0.15
123 0.2
124 0.3
125 0.38
126 0.42
127 0.48
128 0.53
129 0.6
130 0.68
131 0.72
132 0.68
133 0.69
134 0.71
135 0.68
136 0.66
137 0.56
138 0.5
139 0.47
140 0.44
141 0.39
142 0.32
143 0.27
144 0.28
145 0.28
146 0.25
147 0.24
148 0.25
149 0.21
150 0.22
151 0.23
152 0.22
153 0.22
154 0.21
155 0.18
156 0.18
157 0.21
158 0.22
159 0.23
160 0.24
161 0.27
162 0.29
163 0.31
164 0.37
165 0.44
166 0.52
167 0.61
168 0.7
169 0.76
170 0.81
171 0.86
172 0.85
173 0.81
174 0.75
175 0.66
176 0.63
177 0.57
178 0.51
179 0.43
180 0.35
181 0.29
182 0.29
183 0.26
184 0.2
185 0.16
186 0.14
187 0.12
188 0.12
189 0.12
190 0.09
191 0.09
192 0.09
193 0.1
194 0.09
195 0.1
196 0.1
197 0.1
198 0.1
199 0.1
200 0.08
201 0.1
202 0.11
203 0.13
204 0.15
205 0.17
206 0.21
207 0.21
208 0.26
209 0.25
210 0.32
211 0.33
212 0.31
213 0.39
214 0.35
215 0.37
216 0.33
217 0.31
218 0.23
219 0.19
220 0.19
221 0.09
222 0.08
223 0.05
224 0.07
225 0.07
226 0.08
227 0.08
228 0.08
229 0.08
230 0.09
231 0.1
232 0.13
233 0.19