Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3CDQ9

Protein Details
Accession S3CDQ9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
121-148TDEDSRKPKRPKTVAKKLKKTSRSAKPHBasic
NLS Segment(s)
PositionSequence
126-147RKPKRPKTVAKKLKKTSRSAKP
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
KEGG glz:GLAREA_08000  -  
Amino Acid Sequences MTVKKKKGLAAVKPNREYDDKDLPARNIKGKGKSTTADHTKTKKASLLASNPDMTKRRRPATTSTAKKDESPPPTITKRSVPSSLLADLERLTPKRTTRQTSKSDTFHRETLLAAYSGSDTDEDSRKPKRPKTVAKKLKKTSRSAKPHSSGPDLEEIESEIIYRAVGVAFEDTFRFYRKLVEKIVHLLLNPIFIGKNAEFDFASQHLSDFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.69
3 0.63
4 0.58
5 0.54
6 0.54
7 0.48
8 0.49
9 0.51
10 0.5
11 0.54
12 0.53
13 0.52
14 0.5
15 0.53
16 0.55
17 0.57
18 0.58
19 0.54
20 0.53
21 0.52
22 0.53
23 0.55
24 0.52
25 0.53
26 0.54
27 0.57
28 0.56
29 0.54
30 0.48
31 0.42
32 0.42
33 0.42
34 0.44
35 0.42
36 0.43
37 0.43
38 0.39
39 0.42
40 0.41
41 0.38
42 0.41
43 0.42
44 0.45
45 0.47
46 0.5
47 0.52
48 0.57
49 0.64
50 0.63
51 0.62
52 0.62
53 0.59
54 0.58
55 0.56
56 0.54
57 0.48
58 0.44
59 0.4
60 0.41
61 0.44
62 0.44
63 0.41
64 0.39
65 0.38
66 0.37
67 0.37
68 0.32
69 0.29
70 0.29
71 0.28
72 0.23
73 0.19
74 0.15
75 0.13
76 0.14
77 0.15
78 0.13
79 0.14
80 0.15
81 0.18
82 0.25
83 0.31
84 0.36
85 0.42
86 0.49
87 0.54
88 0.59
89 0.62
90 0.59
91 0.59
92 0.57
93 0.52
94 0.45
95 0.39
96 0.31
97 0.26
98 0.22
99 0.17
100 0.11
101 0.08
102 0.07
103 0.07
104 0.06
105 0.06
106 0.05
107 0.05
108 0.07
109 0.09
110 0.1
111 0.14
112 0.19
113 0.26
114 0.34
115 0.39
116 0.47
117 0.55
118 0.65
119 0.72
120 0.78
121 0.81
122 0.84
123 0.89
124 0.88
125 0.88
126 0.84
127 0.82
128 0.8
129 0.8
130 0.8
131 0.77
132 0.77
133 0.71
134 0.7
135 0.67
136 0.61
137 0.52
138 0.44
139 0.43
140 0.34
141 0.31
142 0.25
143 0.21
144 0.17
145 0.15
146 0.13
147 0.07
148 0.06
149 0.06
150 0.05
151 0.05
152 0.04
153 0.04
154 0.05
155 0.06
156 0.06
157 0.07
158 0.08
159 0.1
160 0.11
161 0.14
162 0.15
163 0.14
164 0.22
165 0.27
166 0.32
167 0.35
168 0.38
169 0.38
170 0.42
171 0.46
172 0.38
173 0.33
174 0.31
175 0.26
176 0.24
177 0.21
178 0.17
179 0.13
180 0.12
181 0.18
182 0.14
183 0.19
184 0.19
185 0.21
186 0.2
187 0.2
188 0.24
189 0.19
190 0.22
191 0.16