Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3CHA8

Protein Details
Accession S3CHA8    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
63-84GTTDSFSPKKPKKPTLARRGTDHydrophilic
NLS Segment(s)
PositionSequence
72-75KPKK
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
KEGG glz:GLAREA_08537  -  
Amino Acid Sequences MSLSRIPLTQVFRAKSNSTSSTSSTPDLSSLSPSDLSSPYDVLGDLYPKDITPKDITPIVRRGTTDSFSPKKPKKPTLARRGTDSVIPTDDIVPRTILSPKKSSPKPVPAVVRNNMSQSNGGPRAAGNRNAKMLEYERQAEERAKEQARMEEERQRMSTEQMNIAQEQERIAQEQYEMDQYYEAEALRHAEEMRIHQDEVRRHQARVREHQMRLQDHEASSEAFARVIAMPAKPGRDREVSFLGPARTNSTKMTSNGANGNGTAPAQFPGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.43
3 0.44
4 0.42
5 0.39
6 0.4
7 0.39
8 0.38
9 0.39
10 0.37
11 0.32
12 0.28
13 0.24
14 0.23
15 0.2
16 0.19
17 0.17
18 0.17
19 0.17
20 0.16
21 0.18
22 0.18
23 0.19
24 0.17
25 0.17
26 0.15
27 0.14
28 0.14
29 0.12
30 0.12
31 0.12
32 0.1
33 0.12
34 0.12
35 0.11
36 0.15
37 0.14
38 0.18
39 0.2
40 0.22
41 0.23
42 0.28
43 0.31
44 0.33
45 0.39
46 0.37
47 0.35
48 0.34
49 0.35
50 0.35
51 0.33
52 0.32
53 0.34
54 0.36
55 0.39
56 0.49
57 0.51
58 0.56
59 0.63
60 0.67
61 0.69
62 0.76
63 0.81
64 0.82
65 0.86
66 0.78
67 0.76
68 0.72
69 0.62
70 0.54
71 0.45
72 0.35
73 0.26
74 0.25
75 0.18
76 0.16
77 0.17
78 0.15
79 0.14
80 0.13
81 0.11
82 0.12
83 0.17
84 0.19
85 0.21
86 0.24
87 0.28
88 0.37
89 0.39
90 0.45
91 0.48
92 0.53
93 0.54
94 0.55
95 0.58
96 0.56
97 0.6
98 0.56
99 0.52
100 0.44
101 0.41
102 0.36
103 0.3
104 0.24
105 0.17
106 0.2
107 0.18
108 0.17
109 0.15
110 0.14
111 0.2
112 0.21
113 0.28
114 0.25
115 0.25
116 0.27
117 0.27
118 0.27
119 0.23
120 0.23
121 0.19
122 0.18
123 0.18
124 0.17
125 0.18
126 0.19
127 0.19
128 0.18
129 0.16
130 0.2
131 0.19
132 0.21
133 0.21
134 0.23
135 0.25
136 0.28
137 0.29
138 0.3
139 0.31
140 0.32
141 0.31
142 0.29
143 0.26
144 0.24
145 0.26
146 0.2
147 0.21
148 0.21
149 0.21
150 0.2
151 0.21
152 0.2
153 0.15
154 0.14
155 0.14
156 0.11
157 0.12
158 0.12
159 0.11
160 0.1
161 0.1
162 0.1
163 0.11
164 0.11
165 0.1
166 0.1
167 0.09
168 0.1
169 0.1
170 0.09
171 0.07
172 0.06
173 0.08
174 0.08
175 0.09
176 0.09
177 0.1
178 0.11
179 0.14
180 0.19
181 0.19
182 0.19
183 0.2
184 0.26
185 0.3
186 0.36
187 0.43
188 0.4
189 0.39
190 0.42
191 0.47
192 0.5
193 0.54
194 0.57
195 0.55
196 0.55
197 0.59
198 0.63
199 0.6
200 0.57
201 0.51
202 0.45
203 0.36
204 0.36
205 0.33
206 0.26
207 0.23
208 0.19
209 0.15
210 0.12
211 0.11
212 0.11
213 0.1
214 0.12
215 0.13
216 0.11
217 0.15
218 0.17
219 0.23
220 0.24
221 0.26
222 0.29
223 0.34
224 0.36
225 0.37
226 0.41
227 0.38
228 0.38
229 0.39
230 0.37
231 0.33
232 0.32
233 0.33
234 0.3
235 0.3
236 0.31
237 0.31
238 0.34
239 0.32
240 0.37
241 0.33
242 0.34
243 0.37
244 0.36
245 0.32
246 0.27
247 0.27
248 0.22
249 0.2
250 0.16
251 0.13