Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3DPG6

Protein Details
Accession S3DPG6   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
42-63EEVPGRKKKVDKKVEKDKMEREBasic
NLS Segment(s)
PositionSequence
46-56GRKKKVDKKVE
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 8, cyto 6.5
Family & Domain DBs
KEGG glz:GLAREA_07004  -  
Amino Acid Sequences MGNTPSHNVRGYARPKGELNPMKHGFWIKDSLLTHPRWKDMEEVPGRKKKVDKKVEKDKMEREMFQKGWEAAMAANAKAGGGVGGTGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.45
4 0.52
5 0.5
6 0.48
7 0.49
8 0.5
9 0.47
10 0.47
11 0.46
12 0.36
13 0.31
14 0.31
15 0.21
16 0.24
17 0.24
18 0.27
19 0.29
20 0.3
21 0.33
22 0.3
23 0.33
24 0.28
25 0.29
26 0.28
27 0.24
28 0.31
29 0.31
30 0.36
31 0.39
32 0.44
33 0.44
34 0.42
35 0.47
36 0.46
37 0.5
38 0.56
39 0.6
40 0.64
41 0.75
42 0.82
43 0.82
44 0.8
45 0.75
46 0.74
47 0.67
48 0.61
49 0.52
50 0.5
51 0.44
52 0.39
53 0.37
54 0.28
55 0.25
56 0.22
57 0.19
58 0.12
59 0.16
60 0.16
61 0.12
62 0.12
63 0.11
64 0.11
65 0.1
66 0.1
67 0.05
68 0.04