Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3CP70

Protein Details
Accession S3CP70    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
44-63SRLFRQSRDTRKPSREQQDGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 10.166, mito 9.5, cyto 9.5, cyto_nucl 8.833, nucl 6
Family & Domain DBs
KEGG glz:GLAREA_09382  -  
Amino Acid Sequences MVVEAIPLSLRPVEAWSSSEHRIVGSRIREPVLSSAKLLLIPASRLFRQSRDTRKPSREQQDGDAVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.16
4 0.2
5 0.22
6 0.22
7 0.2
8 0.19
9 0.19
10 0.2
11 0.22
12 0.21
13 0.21
14 0.22
15 0.22
16 0.22
17 0.21
18 0.25
19 0.23
20 0.2
21 0.18
22 0.17
23 0.16
24 0.16
25 0.15
26 0.11
27 0.07
28 0.08
29 0.11
30 0.14
31 0.14
32 0.17
33 0.19
34 0.21
35 0.28
36 0.35
37 0.43
38 0.5
39 0.58
40 0.64
41 0.71
42 0.77
43 0.8
44 0.81
45 0.79
46 0.72
47 0.7