Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3E1H8

Protein Details
Accession S3E1H8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
56-86NLFMAHGRRRARRREKKLARKQAYQNRVDRKBasic
NLS Segment(s)
PositionSequence
62-76GRRRARRREKKLARK
Subcellular Location(s) mito 17, cyto 3, extr 3, plas 2, cyto_nucl 2, cyto_pero 2
Family & Domain DBs
KEGG glz:GLAREA_07456  -  
Amino Acid Sequences MRDRACLLVMQLSSLHLKLRNASLPPTHKLKNIFLSQTKAYATPKIQTYLTPKIHNLFMAHGRRRARRREKKLARKQAYQNRVDRKTYSENIHSKCHAPRQDPLVEANTDGVPTSTTTQPSAQSLVSPQIQQTNIFPSEFGIYTSFFTRGITLARSREESKTAPLFRVSIFSSKPHMELRRNNDLRSPRMATATFHRLSPGTDICLSQPGETDVNIILQNREAFTLASSFVVPIRSGLMKSFRWKNSRGVEVASLHGYGHGAKLVRETTGQVVAAWTVASTRWRSHRKMAWIAASGGQDPREELGAWFELASVMTCMVIIELKRRQAAARSAAAASYQPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.18
4 0.2
5 0.23
6 0.28
7 0.32
8 0.32
9 0.36
10 0.41
11 0.43
12 0.47
13 0.5
14 0.48
15 0.47
16 0.5
17 0.52
18 0.52
19 0.53
20 0.55
21 0.52
22 0.54
23 0.51
24 0.49
25 0.44
26 0.39
27 0.34
28 0.33
29 0.31
30 0.31
31 0.33
32 0.33
33 0.32
34 0.33
35 0.38
36 0.42
37 0.45
38 0.43
39 0.43
40 0.43
41 0.43
42 0.41
43 0.35
44 0.29
45 0.33
46 0.38
47 0.41
48 0.44
49 0.49
50 0.56
51 0.62
52 0.69
53 0.72
54 0.73
55 0.79
56 0.84
57 0.89
58 0.91
59 0.95
60 0.95
61 0.91
62 0.89
63 0.89
64 0.88
65 0.86
66 0.83
67 0.8
68 0.79
69 0.77
70 0.71
71 0.62
72 0.58
73 0.56
74 0.54
75 0.51
76 0.5
77 0.52
78 0.52
79 0.56
80 0.51
81 0.47
82 0.47
83 0.5
84 0.47
85 0.42
86 0.44
87 0.45
88 0.47
89 0.44
90 0.42
91 0.37
92 0.3
93 0.27
94 0.24
95 0.17
96 0.14
97 0.12
98 0.1
99 0.07
100 0.07
101 0.1
102 0.11
103 0.12
104 0.13
105 0.15
106 0.16
107 0.16
108 0.17
109 0.14
110 0.13
111 0.13
112 0.15
113 0.15
114 0.14
115 0.14
116 0.16
117 0.17
118 0.17
119 0.17
120 0.18
121 0.18
122 0.17
123 0.16
124 0.13
125 0.14
126 0.14
127 0.13
128 0.09
129 0.09
130 0.1
131 0.11
132 0.11
133 0.09
134 0.09
135 0.09
136 0.08
137 0.09
138 0.1
139 0.12
140 0.13
141 0.14
142 0.17
143 0.19
144 0.2
145 0.22
146 0.2
147 0.22
148 0.27
149 0.26
150 0.24
151 0.23
152 0.22
153 0.19
154 0.21
155 0.17
156 0.14
157 0.14
158 0.15
159 0.17
160 0.17
161 0.19
162 0.21
163 0.25
164 0.29
165 0.35
166 0.4
167 0.48
168 0.49
169 0.48
170 0.48
171 0.48
172 0.45
173 0.43
174 0.39
175 0.29
176 0.3
177 0.3
178 0.26
179 0.26
180 0.3
181 0.26
182 0.23
183 0.23
184 0.2
185 0.2
186 0.23
187 0.18
188 0.13
189 0.14
190 0.14
191 0.14
192 0.18
193 0.17
194 0.14
195 0.13
196 0.13
197 0.13
198 0.12
199 0.13
200 0.09
201 0.1
202 0.11
203 0.11
204 0.09
205 0.1
206 0.1
207 0.1
208 0.1
209 0.09
210 0.08
211 0.08
212 0.09
213 0.08
214 0.08
215 0.07
216 0.07
217 0.08
218 0.09
219 0.08
220 0.07
221 0.09
222 0.1
223 0.1
224 0.12
225 0.16
226 0.18
227 0.25
228 0.34
229 0.38
230 0.42
231 0.45
232 0.51
233 0.52
234 0.55
235 0.49
236 0.43
237 0.4
238 0.36
239 0.35
240 0.28
241 0.22
242 0.16
243 0.15
244 0.13
245 0.1
246 0.09
247 0.09
248 0.09
249 0.09
250 0.12
251 0.12
252 0.13
253 0.13
254 0.15
255 0.15
256 0.17
257 0.17
258 0.13
259 0.13
260 0.12
261 0.12
262 0.1
263 0.07
264 0.05
265 0.06
266 0.1
267 0.12
268 0.17
269 0.27
270 0.34
271 0.39
272 0.48
273 0.54
274 0.59
275 0.66
276 0.67
277 0.63
278 0.58
279 0.55
280 0.5
281 0.44
282 0.37
283 0.3
284 0.26
285 0.2
286 0.18
287 0.17
288 0.14
289 0.14
290 0.12
291 0.14
292 0.14
293 0.14
294 0.13
295 0.12
296 0.11
297 0.11
298 0.11
299 0.08
300 0.06
301 0.06
302 0.06
303 0.06
304 0.06
305 0.09
306 0.09
307 0.16
308 0.21
309 0.26
310 0.28
311 0.29
312 0.32
313 0.36
314 0.43
315 0.43
316 0.42
317 0.4
318 0.39
319 0.38
320 0.36