Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3DTD7

Protein Details
Accession S3DTD7   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
110-130LADKLKNKLFKKKVAKEEAKAHydrophilic
NLS Segment(s)
PositionSequence
115-129KNKLFKKKVAKEEAK
Subcellular Location(s) mito 9cyto_nucl 9, nucl 7, cyto 7, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
KEGG glz:GLAREA_00843  -  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MSTPKGSMEVSHGRGGAGNIGTDNTVYGDGEIVREGAVGDHGDGAFSTGRGGAANIGSPKVGATARKDEIAIPEVALRPSMEDQNYHTGRGGQGNAHLTGPQGTKHPEGLADKLKNKLFKKKVAKEEAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.24
4 0.17
5 0.13
6 0.11
7 0.11
8 0.11
9 0.1
10 0.1
11 0.07
12 0.07
13 0.06
14 0.06
15 0.07
16 0.06
17 0.07
18 0.07
19 0.06
20 0.05
21 0.05
22 0.05
23 0.04
24 0.05
25 0.05
26 0.05
27 0.06
28 0.05
29 0.05
30 0.05
31 0.06
32 0.06
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.07
42 0.07
43 0.07
44 0.07
45 0.06
46 0.06
47 0.07
48 0.08
49 0.08
50 0.11
51 0.16
52 0.17
53 0.17
54 0.18
55 0.17
56 0.18
57 0.18
58 0.15
59 0.1
60 0.11
61 0.11
62 0.11
63 0.11
64 0.09
65 0.08
66 0.1
67 0.12
68 0.11
69 0.11
70 0.14
71 0.23
72 0.24
73 0.23
74 0.22
75 0.2
76 0.21
77 0.23
78 0.21
79 0.13
80 0.16
81 0.18
82 0.18
83 0.17
84 0.16
85 0.14
86 0.16
87 0.16
88 0.14
89 0.15
90 0.18
91 0.19
92 0.2
93 0.21
94 0.21
95 0.23
96 0.28
97 0.34
98 0.37
99 0.39
100 0.44
101 0.48
102 0.52
103 0.55
104 0.6
105 0.59
106 0.62
107 0.7
108 0.73
109 0.79
110 0.82