Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3CDC5

Protein Details
Accession S3CDC5    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
107-132INLENMPTRPHRRRREKKLMTMDEVNHydrophilic
406-428GDNATASRRWNPFRRNRPAAATPHydrophilic
NLS Segment(s)
PositionSequence
116-123PHRRRREK
Subcellular Location(s) cyto 8.5, cyto_nucl 7, nucl 4.5, extr 4, E.R. 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0016020  C:membrane  
KEGG glz:GLAREA_08389  -  
Pfam View protein in Pfam  
PF13639  zf-RING_2  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
CDD cd16473  RING-H2_RNF103  
Amino Acid Sequences MVVNELMVEVLHVLQRDLSARNLGGTQTTPSPTAAQSQTVSTTVPAPTPTMTSSGGGGPTSSPLLFFVALGFGVVFTNLWIIVGVKYCFRYNARNRALRNGEDGDPINLENMPTRPHRRRREKKLMTMDEVNDRFPLTKYKNWVAARAREGLSTSGGVNAPSSRPGSLRDVDGVVPSSPVDTKHSVNTRPATASSEIEPTPAIITTDRKSMDVKAVEKDNAVTTVEEQNNLEQVKTTASTVDKQPTAVSELDDDDEDDHIHTAVPPELLTNPGDSCAICIDTLEDDDDIRGLTCGHAFHAGCLDPWLTSRRACCPLCKADYYTPKPRPEGEAAEPERSGRSNRRRTEQANMVQQPPSAWTGIRGHPRFGAIGGRFGIMQETTGDQSRNARRARRAQANVQPEVGTGDNATASRRWNPFRRNRPAAATPVEAAPETATPSQLEAGVVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.14
4 0.15
5 0.16
6 0.19
7 0.19
8 0.2
9 0.21
10 0.19
11 0.19
12 0.18
13 0.19
14 0.19
15 0.21
16 0.21
17 0.21
18 0.23
19 0.21
20 0.27
21 0.26
22 0.25
23 0.24
24 0.25
25 0.25
26 0.24
27 0.23
28 0.17
29 0.19
30 0.16
31 0.17
32 0.16
33 0.15
34 0.16
35 0.17
36 0.17
37 0.18
38 0.18
39 0.17
40 0.17
41 0.17
42 0.17
43 0.15
44 0.14
45 0.12
46 0.12
47 0.13
48 0.12
49 0.1
50 0.1
51 0.12
52 0.11
53 0.11
54 0.09
55 0.08
56 0.08
57 0.08
58 0.07
59 0.05
60 0.05
61 0.05
62 0.05
63 0.04
64 0.05
65 0.04
66 0.05
67 0.04
68 0.05
69 0.07
70 0.1
71 0.11
72 0.13
73 0.15
74 0.16
75 0.2
76 0.22
77 0.31
78 0.37
79 0.48
80 0.54
81 0.59
82 0.6
83 0.66
84 0.68
85 0.6
86 0.56
87 0.5
88 0.42
89 0.39
90 0.38
91 0.29
92 0.24
93 0.22
94 0.17
95 0.13
96 0.12
97 0.11
98 0.11
99 0.14
100 0.19
101 0.29
102 0.38
103 0.48
104 0.59
105 0.68
106 0.78
107 0.85
108 0.9
109 0.9
110 0.91
111 0.91
112 0.87
113 0.81
114 0.75
115 0.67
116 0.64
117 0.55
118 0.46
119 0.35
120 0.29
121 0.24
122 0.2
123 0.26
124 0.22
125 0.25
126 0.31
127 0.35
128 0.43
129 0.43
130 0.5
131 0.47
132 0.49
133 0.48
134 0.46
135 0.43
136 0.34
137 0.35
138 0.28
139 0.23
140 0.17
141 0.14
142 0.11
143 0.11
144 0.1
145 0.1
146 0.1
147 0.09
148 0.11
149 0.11
150 0.1
151 0.11
152 0.14
153 0.18
154 0.19
155 0.19
156 0.18
157 0.18
158 0.18
159 0.18
160 0.16
161 0.11
162 0.1
163 0.09
164 0.08
165 0.08
166 0.08
167 0.12
168 0.13
169 0.14
170 0.2
171 0.25
172 0.26
173 0.31
174 0.32
175 0.3
176 0.29
177 0.28
178 0.26
179 0.23
180 0.22
181 0.18
182 0.19
183 0.17
184 0.16
185 0.15
186 0.11
187 0.1
188 0.09
189 0.08
190 0.06
191 0.09
192 0.1
193 0.14
194 0.14
195 0.15
196 0.16
197 0.16
198 0.21
199 0.21
200 0.22
201 0.21
202 0.22
203 0.22
204 0.21
205 0.21
206 0.16
207 0.13
208 0.12
209 0.09
210 0.09
211 0.15
212 0.15
213 0.15
214 0.14
215 0.14
216 0.16
217 0.16
218 0.14
219 0.08
220 0.08
221 0.09
222 0.09
223 0.09
224 0.08
225 0.09
226 0.11
227 0.13
228 0.17
229 0.16
230 0.16
231 0.16
232 0.15
233 0.17
234 0.15
235 0.13
236 0.1
237 0.1
238 0.11
239 0.1
240 0.1
241 0.07
242 0.07
243 0.07
244 0.06
245 0.06
246 0.05
247 0.05
248 0.06
249 0.06
250 0.07
251 0.07
252 0.06
253 0.07
254 0.07
255 0.09
256 0.09
257 0.09
258 0.08
259 0.08
260 0.09
261 0.08
262 0.08
263 0.08
264 0.08
265 0.06
266 0.06
267 0.06
268 0.06
269 0.07
270 0.07
271 0.06
272 0.06
273 0.06
274 0.06
275 0.05
276 0.05
277 0.05
278 0.04
279 0.05
280 0.06
281 0.06
282 0.07
283 0.11
284 0.11
285 0.11
286 0.14
287 0.14
288 0.12
289 0.14
290 0.13
291 0.09
292 0.1
293 0.14
294 0.13
295 0.15
296 0.17
297 0.22
298 0.3
299 0.31
300 0.33
301 0.37
302 0.43
303 0.45
304 0.46
305 0.45
306 0.45
307 0.54
308 0.57
309 0.6
310 0.61
311 0.61
312 0.61
313 0.58
314 0.55
315 0.5
316 0.49
317 0.43
318 0.46
319 0.44
320 0.44
321 0.42
322 0.37
323 0.33
324 0.29
325 0.29
326 0.29
327 0.37
328 0.44
329 0.5
330 0.57
331 0.64
332 0.66
333 0.7
334 0.69
335 0.66
336 0.67
337 0.65
338 0.6
339 0.53
340 0.5
341 0.41
342 0.34
343 0.27
344 0.18
345 0.14
346 0.16
347 0.19
348 0.26
349 0.36
350 0.35
351 0.35
352 0.35
353 0.37
354 0.33
355 0.29
356 0.31
357 0.21
358 0.24
359 0.23
360 0.22
361 0.2
362 0.19
363 0.2
364 0.12
365 0.12
366 0.09
367 0.1
368 0.12
369 0.15
370 0.15
371 0.15
372 0.24
373 0.31
374 0.37
375 0.42
376 0.47
377 0.53
378 0.63
379 0.71
380 0.73
381 0.73
382 0.75
383 0.77
384 0.78
385 0.71
386 0.63
387 0.53
388 0.43
389 0.39
390 0.3
391 0.22
392 0.14
393 0.12
394 0.12
395 0.12
396 0.14
397 0.12
398 0.15
399 0.22
400 0.29
401 0.37
402 0.45
403 0.56
404 0.65
405 0.74
406 0.81
407 0.82
408 0.8
409 0.8
410 0.77
411 0.74
412 0.68
413 0.61
414 0.51
415 0.44
416 0.4
417 0.32
418 0.26
419 0.2
420 0.15
421 0.17
422 0.16
423 0.16
424 0.15
425 0.16
426 0.16
427 0.16