Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3DH35

Protein Details
Accession S3DH35   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-27SVSNRPRSSRSQSPKRHEDQLKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 11.5, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015947  PUA-like_sf  
KEGG glz:GLAREA_12624  -  
Amino Acid Sequences MPLIDSVSNRPRSSRSQSPKRHEDQLKGDRVADRKTLRSARISTQADVILPMREPYMQQIVNGEKNYEFRKYRLKASVKRIWFYSTAPQSSIEYVCEILPAKTRNAGDLALEEDGLGNKEFNERHKDWEGYDFAYEVTSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.62
4 0.72
5 0.78
6 0.83
7 0.81
8 0.82
9 0.77
10 0.74
11 0.74
12 0.73
13 0.71
14 0.63
15 0.6
16 0.54
17 0.52
18 0.47
19 0.44
20 0.38
21 0.34
22 0.4
23 0.43
24 0.41
25 0.44
26 0.43
27 0.4
28 0.47
29 0.46
30 0.39
31 0.36
32 0.33
33 0.27
34 0.25
35 0.21
36 0.12
37 0.1
38 0.1
39 0.08
40 0.08
41 0.08
42 0.09
43 0.14
44 0.13
45 0.13
46 0.16
47 0.18
48 0.22
49 0.22
50 0.2
51 0.15
52 0.18
53 0.2
54 0.22
55 0.2
56 0.19
57 0.28
58 0.29
59 0.34
60 0.4
61 0.47
62 0.49
63 0.57
64 0.62
65 0.56
66 0.55
67 0.51
68 0.45
69 0.38
70 0.33
71 0.32
72 0.3
73 0.27
74 0.27
75 0.27
76 0.25
77 0.25
78 0.24
79 0.16
80 0.12
81 0.11
82 0.1
83 0.11
84 0.1
85 0.09
86 0.14
87 0.15
88 0.15
89 0.19
90 0.2
91 0.2
92 0.21
93 0.2
94 0.16
95 0.15
96 0.16
97 0.12
98 0.11
99 0.1
100 0.08
101 0.09
102 0.1
103 0.09
104 0.07
105 0.07
106 0.12
107 0.14
108 0.19
109 0.27
110 0.27
111 0.34
112 0.4
113 0.42
114 0.39
115 0.44
116 0.42
117 0.35
118 0.35
119 0.28
120 0.22