Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3DAG7

Protein Details
Accession S3DAG7   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MIRPSTHQKHQRVRSSYRDNDHydrophilic
219-240LTEMERKKKNDNAIRRLHKKVAHydrophilic
NLS Segment(s)
PositionSequence
225-227KKK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.833, mito_nucl 13.332
Family & Domain DBs
InterPro View protein in InterPro  
IPR043129  ATPase_NBD  
IPR013126  Hsp_70_fam  
Gene Ontology GO:0005524  F:ATP binding  
GO:0140662  F:ATP-dependent protein folding chaperone  
KEGG glz:GLAREA_00124  -  
Pfam View protein in Pfam  
PF00012  HSP70  
Amino Acid Sequences MIRPSTHQKHQRVRSSYRDNDMNHKNKLDQHKKELSSNGRVLRRLRKACDRAKRALSTPAQNFIGIDSFVEGMDMYTSITNSRFEETCKDFSRMSMDSEKSRKGRPIDKKSISAPSFGSEGSFGGYVRNSVVEEPFDHGNLLGNQPERKPSIKRSHSLGSFVSSTFQKTPSQTPGPPINTSLGPKKFTIKRPLGMNPDETEIHHLRRMAARPRDVSERLTEMERKKKNDNAIRRLHKKVAANIETAKTAATKTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.79
4 0.76
5 0.74
6 0.67
7 0.68
8 0.71
9 0.68
10 0.63
11 0.59
12 0.55
13 0.56
14 0.64
15 0.65
16 0.62
17 0.64
18 0.68
19 0.68
20 0.7
21 0.71
22 0.67
23 0.64
24 0.63
25 0.62
26 0.57
27 0.58
28 0.59
29 0.6
30 0.63
31 0.62
32 0.62
33 0.65
34 0.7
35 0.75
36 0.79
37 0.76
38 0.74
39 0.75
40 0.72
41 0.64
42 0.63
43 0.59
44 0.57
45 0.53
46 0.5
47 0.43
48 0.39
49 0.36
50 0.28
51 0.24
52 0.15
53 0.13
54 0.08
55 0.07
56 0.07
57 0.07
58 0.06
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.06
66 0.07
67 0.09
68 0.09
69 0.12
70 0.12
71 0.13
72 0.19
73 0.23
74 0.28
75 0.3
76 0.31
77 0.29
78 0.29
79 0.33
80 0.28
81 0.27
82 0.26
83 0.26
84 0.29
85 0.32
86 0.37
87 0.35
88 0.36
89 0.38
90 0.37
91 0.44
92 0.49
93 0.56
94 0.61
95 0.62
96 0.62
97 0.6
98 0.64
99 0.55
100 0.46
101 0.36
102 0.27
103 0.24
104 0.2
105 0.18
106 0.09
107 0.08
108 0.07
109 0.07
110 0.06
111 0.05
112 0.06
113 0.05
114 0.05
115 0.06
116 0.05
117 0.05
118 0.06
119 0.06
120 0.07
121 0.09
122 0.09
123 0.09
124 0.09
125 0.08
126 0.09
127 0.1
128 0.1
129 0.1
130 0.11
131 0.13
132 0.13
133 0.16
134 0.17
135 0.19
136 0.22
137 0.29
138 0.38
139 0.43
140 0.45
141 0.48
142 0.52
143 0.5
144 0.49
145 0.4
146 0.32
147 0.27
148 0.25
149 0.21
150 0.15
151 0.16
152 0.15
153 0.16
154 0.16
155 0.18
156 0.22
157 0.27
158 0.31
159 0.3
160 0.34
161 0.4
162 0.41
163 0.39
164 0.37
165 0.32
166 0.29
167 0.31
168 0.34
169 0.3
170 0.29
171 0.29
172 0.35
173 0.4
174 0.46
175 0.53
176 0.51
177 0.52
178 0.56
179 0.62
180 0.61
181 0.56
182 0.52
183 0.44
184 0.41
185 0.37
186 0.31
187 0.31
188 0.27
189 0.27
190 0.26
191 0.25
192 0.24
193 0.3
194 0.36
195 0.39
196 0.44
197 0.48
198 0.49
199 0.53
200 0.57
201 0.53
202 0.49
203 0.43
204 0.39
205 0.35
206 0.36
207 0.39
208 0.39
209 0.47
210 0.51
211 0.52
212 0.56
213 0.6
214 0.66
215 0.7
216 0.73
217 0.72
218 0.76
219 0.81
220 0.82
221 0.82
222 0.78
223 0.75
224 0.71
225 0.69
226 0.69
227 0.62
228 0.59
229 0.56
230 0.52
231 0.46
232 0.4
233 0.32
234 0.22