Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3D0T9

Protein Details
Accession S3D0T9   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
281-306NGGEGQKRRREEKKAAKKLIREQLAEBasic
NLS Segment(s)
PositionSequence
283-299GEGQKRRREEKKAAKKL
Subcellular Location(s) cyto 10.5, cyto_nucl 9.5, nucl 7.5, cysk 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR040151  Gfd2/YDR514C-like  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG glz:GLAREA_03731  -  
Amino Acid Sequences MNAEFLINVENGPLVEMANRIPPDGVMREETFALRDLLGLYGQDLVFSADGTPSHVRSVIKDVLLLALDFEGEICSPAAPLGFRLGISVLDTRRLKDLAESQFRDGGADIQDAIRTCSFCTGPSMDCLKERRKEIFGNAREMKIEEMRTTIQALISGRHVVLVVHGGENDLRFLERLQIPIQPLYIIDTQKAAQNPLGLTARPSLETLLTILEIPHVPSILHVAGNDATYTLRSLLMIAVKDAEMAHGLDDKQQALVVILCKLAGSPLPESVKKQYANRGNGGEGQKRRREEKKAAKKLIREQLAEIQAVEASKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.09
4 0.1
5 0.16
6 0.16
7 0.16
8 0.16
9 0.16
10 0.2
11 0.22
12 0.23
13 0.21
14 0.22
15 0.23
16 0.24
17 0.24
18 0.21
19 0.19
20 0.18
21 0.13
22 0.12
23 0.11
24 0.1
25 0.1
26 0.09
27 0.08
28 0.1
29 0.09
30 0.09
31 0.08
32 0.09
33 0.08
34 0.09
35 0.08
36 0.07
37 0.07
38 0.12
39 0.14
40 0.14
41 0.15
42 0.18
43 0.18
44 0.19
45 0.26
46 0.25
47 0.23
48 0.23
49 0.22
50 0.2
51 0.2
52 0.17
53 0.11
54 0.07
55 0.06
56 0.05
57 0.05
58 0.05
59 0.04
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.06
66 0.05
67 0.06
68 0.08
69 0.08
70 0.08
71 0.09
72 0.09
73 0.09
74 0.1
75 0.13
76 0.11
77 0.18
78 0.19
79 0.2
80 0.22
81 0.22
82 0.2
83 0.2
84 0.28
85 0.29
86 0.37
87 0.38
88 0.37
89 0.39
90 0.39
91 0.36
92 0.28
93 0.21
94 0.14
95 0.12
96 0.11
97 0.09
98 0.1
99 0.1
100 0.11
101 0.1
102 0.09
103 0.09
104 0.12
105 0.12
106 0.11
107 0.14
108 0.14
109 0.13
110 0.17
111 0.19
112 0.18
113 0.21
114 0.25
115 0.29
116 0.32
117 0.35
118 0.35
119 0.36
120 0.37
121 0.41
122 0.47
123 0.43
124 0.47
125 0.45
126 0.42
127 0.38
128 0.36
129 0.3
130 0.23
131 0.21
132 0.13
133 0.13
134 0.13
135 0.13
136 0.13
137 0.12
138 0.09
139 0.1
140 0.1
141 0.09
142 0.09
143 0.09
144 0.08
145 0.08
146 0.08
147 0.06
148 0.06
149 0.07
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.05
158 0.04
159 0.05
160 0.05
161 0.1
162 0.1
163 0.12
164 0.13
165 0.15
166 0.16
167 0.17
168 0.17
169 0.12
170 0.11
171 0.12
172 0.15
173 0.13
174 0.12
175 0.12
176 0.13
177 0.16
178 0.16
179 0.14
180 0.12
181 0.13
182 0.13
183 0.16
184 0.17
185 0.13
186 0.14
187 0.15
188 0.15
189 0.14
190 0.14
191 0.11
192 0.1
193 0.1
194 0.09
195 0.08
196 0.07
197 0.06
198 0.06
199 0.07
200 0.07
201 0.07
202 0.07
203 0.07
204 0.06
205 0.07
206 0.1
207 0.09
208 0.09
209 0.08
210 0.1
211 0.1
212 0.11
213 0.11
214 0.08
215 0.07
216 0.07
217 0.08
218 0.07
219 0.06
220 0.06
221 0.07
222 0.08
223 0.11
224 0.1
225 0.1
226 0.1
227 0.1
228 0.11
229 0.1
230 0.09
231 0.07
232 0.07
233 0.07
234 0.09
235 0.09
236 0.13
237 0.14
238 0.14
239 0.13
240 0.13
241 0.13
242 0.11
243 0.13
244 0.11
245 0.1
246 0.1
247 0.09
248 0.09
249 0.09
250 0.09
251 0.09
252 0.1
253 0.11
254 0.17
255 0.22
256 0.24
257 0.28
258 0.33
259 0.39
260 0.4
261 0.43
262 0.48
263 0.52
264 0.56
265 0.58
266 0.55
267 0.5
268 0.53
269 0.54
270 0.53
271 0.52
272 0.55
273 0.57
274 0.59
275 0.65
276 0.67
277 0.69
278 0.72
279 0.75
280 0.78
281 0.81
282 0.87
283 0.86
284 0.86
285 0.87
286 0.86
287 0.81
288 0.72
289 0.66
290 0.64
291 0.6
292 0.52
293 0.43
294 0.33
295 0.27