Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3CTK2

Protein Details
Accession S3CTK2    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-29GGATRGGKIKNTRKKGPPPATKKSAAHydrophilic
NLS Segment(s)
PositionSequence
8-39RGGKIKNTRKKGPPPATKKSAAGAAGGKPKIL
Subcellular Location(s) cyto 11.5, mito 11, cyto_nucl 7.5, nucl 2.5
Family & Domain DBs
KEGG glz:GLAREA_09474  -  
Amino Acid Sequences MPVGGATRGGKIKNTRKKGPPPATKKSAAGAAGGKPKILKPLYPMTNKGTSNAKPSFMKGVPTPEWNTLLKKQETVLRGPRAKEVTISKLDFVYINLLVGDDVQGVDEPSTNVQSLVLVKEIREYDGEDDLLWIYWCEWREEKWWLSANQEIHKADTVAEVLGDKSVVETERVIGYKKSVEIVRTEGWLKDLLDRALAAGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.66
3 0.72
4 0.82
5 0.86
6 0.87
7 0.87
8 0.86
9 0.87
10 0.85
11 0.79
12 0.7
13 0.62
14 0.56
15 0.45
16 0.39
17 0.32
18 0.3
19 0.34
20 0.32
21 0.29
22 0.26
23 0.26
24 0.32
25 0.3
26 0.26
27 0.24
28 0.34
29 0.41
30 0.44
31 0.47
32 0.44
33 0.5
34 0.48
35 0.46
36 0.43
37 0.37
38 0.4
39 0.38
40 0.37
41 0.31
42 0.33
43 0.37
44 0.31
45 0.31
46 0.26
47 0.3
48 0.29
49 0.32
50 0.33
51 0.29
52 0.31
53 0.3
54 0.32
55 0.3
56 0.35
57 0.31
58 0.29
59 0.28
60 0.3
61 0.31
62 0.32
63 0.35
64 0.36
65 0.39
66 0.39
67 0.42
68 0.39
69 0.37
70 0.35
71 0.31
72 0.28
73 0.29
74 0.28
75 0.24
76 0.22
77 0.22
78 0.18
79 0.15
80 0.13
81 0.08
82 0.07
83 0.07
84 0.06
85 0.06
86 0.06
87 0.05
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.04
95 0.04
96 0.05
97 0.06
98 0.06
99 0.06
100 0.05
101 0.06
102 0.07
103 0.07
104 0.08
105 0.08
106 0.08
107 0.11
108 0.11
109 0.11
110 0.11
111 0.12
112 0.12
113 0.13
114 0.13
115 0.1
116 0.1
117 0.09
118 0.09
119 0.08
120 0.06
121 0.05
122 0.08
123 0.08
124 0.11
125 0.12
126 0.14
127 0.18
128 0.23
129 0.24
130 0.27
131 0.31
132 0.29
133 0.31
134 0.34
135 0.34
136 0.33
137 0.37
138 0.33
139 0.29
140 0.29
141 0.27
142 0.22
143 0.19
144 0.16
145 0.1
146 0.09
147 0.08
148 0.07
149 0.07
150 0.07
151 0.05
152 0.05
153 0.07
154 0.07
155 0.08
156 0.08
157 0.1
158 0.13
159 0.14
160 0.16
161 0.15
162 0.17
163 0.19
164 0.2
165 0.23
166 0.22
167 0.23
168 0.24
169 0.29
170 0.28
171 0.28
172 0.29
173 0.25
174 0.24
175 0.26
176 0.23
177 0.23
178 0.26
179 0.23
180 0.22
181 0.22