Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PCP9

Protein Details
Accession A0A1D8PCP9    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-24AIFISRKSNGKAKKKYNLLSIKSHydrophilic
NLS Segment(s)
PositionSequence
330-333GKKK
Subcellular Location(s) plas 11, mito 9, E.R. 4, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005344  TMEM33/Pom33  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0071786  P:endoplasmic reticulum tubular network organization  
GO:0061024  P:membrane organization  
KEGG cal:CAALFM_C102000WA  -  
Pfam View protein in Pfam  
PF03661  TMEM33_Pom33  
Amino Acid Sequences MAIFISRKSNGKAKKKYNLLSIKSNQILFAFRQCHLFHHPCFPYYSLHTSMPPTQPTPTNSANLRYRTPLQQLVTLAKTQQFYWFLGHVFAVLFFILSTLTGFWNRHSSLKYYRFSLLSIILTYLIVIRQIHFKSTFKLSSINIRLLRDENVQYLLLAVIFYVSSFIIGQTGSSLYSFAIFAVFHVSTYFQNHLLSVFIGDIATQSRISSMISNFTSKFNQPALIAASNAEIVLLVVSGFQLIPSALLLLFRRNIVEVSVQVLVFVAIVVFNKLRFDSNQYTKVVVEQMDLKVNQTLAQINSPQLSQLYQNARAGALKYLSLIKLPKESGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.82
4 0.83
5 0.83
6 0.78
7 0.78
8 0.73
9 0.72
10 0.66
11 0.6
12 0.51
13 0.42
14 0.39
15 0.31
16 0.34
17 0.29
18 0.26
19 0.31
20 0.3
21 0.33
22 0.4
23 0.44
24 0.39
25 0.45
26 0.47
27 0.42
28 0.45
29 0.42
30 0.37
31 0.36
32 0.39
33 0.33
34 0.32
35 0.33
36 0.34
37 0.39
38 0.39
39 0.37
40 0.34
41 0.33
42 0.36
43 0.38
44 0.4
45 0.36
46 0.36
47 0.35
48 0.41
49 0.44
50 0.43
51 0.42
52 0.41
53 0.41
54 0.42
55 0.45
56 0.44
57 0.39
58 0.39
59 0.39
60 0.38
61 0.36
62 0.31
63 0.28
64 0.25
65 0.24
66 0.21
67 0.24
68 0.21
69 0.21
70 0.22
71 0.22
72 0.19
73 0.19
74 0.18
75 0.13
76 0.11
77 0.1
78 0.07
79 0.06
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.06
88 0.08
89 0.09
90 0.1
91 0.16
92 0.17
93 0.2
94 0.21
95 0.25
96 0.32
97 0.39
98 0.4
99 0.37
100 0.39
101 0.36
102 0.35
103 0.32
104 0.25
105 0.17
106 0.16
107 0.13
108 0.11
109 0.1
110 0.09
111 0.08
112 0.05
113 0.06
114 0.06
115 0.06
116 0.12
117 0.13
118 0.15
119 0.18
120 0.18
121 0.2
122 0.25
123 0.25
124 0.2
125 0.23
126 0.21
127 0.28
128 0.3
129 0.33
130 0.31
131 0.3
132 0.31
133 0.29
134 0.3
135 0.24
136 0.22
137 0.17
138 0.16
139 0.15
140 0.13
141 0.12
142 0.1
143 0.07
144 0.05
145 0.04
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.05
164 0.05
165 0.04
166 0.05
167 0.04
168 0.04
169 0.07
170 0.07
171 0.07
172 0.07
173 0.09
174 0.09
175 0.11
176 0.13
177 0.1
178 0.11
179 0.11
180 0.11
181 0.1
182 0.09
183 0.07
184 0.06
185 0.05
186 0.04
187 0.04
188 0.04
189 0.05
190 0.06
191 0.05
192 0.05
193 0.06
194 0.06
195 0.07
196 0.09
197 0.09
198 0.13
199 0.14
200 0.16
201 0.17
202 0.19
203 0.21
204 0.19
205 0.22
206 0.18
207 0.19
208 0.17
209 0.17
210 0.19
211 0.17
212 0.16
213 0.13
214 0.13
215 0.11
216 0.11
217 0.09
218 0.05
219 0.04
220 0.04
221 0.03
222 0.03
223 0.02
224 0.03
225 0.03
226 0.03
227 0.03
228 0.03
229 0.03
230 0.04
231 0.04
232 0.04
233 0.04
234 0.06
235 0.07
236 0.1
237 0.11
238 0.11
239 0.12
240 0.12
241 0.12
242 0.12
243 0.13
244 0.11
245 0.13
246 0.14
247 0.13
248 0.12
249 0.12
250 0.1
251 0.08
252 0.07
253 0.04
254 0.03
255 0.04
256 0.06
257 0.07
258 0.07
259 0.09
260 0.1
261 0.12
262 0.13
263 0.21
264 0.29
265 0.35
266 0.41
267 0.41
268 0.42
269 0.4
270 0.4
271 0.35
272 0.27
273 0.21
274 0.2
275 0.2
276 0.25
277 0.25
278 0.24
279 0.22
280 0.22
281 0.22
282 0.2
283 0.21
284 0.18
285 0.21
286 0.22
287 0.22
288 0.23
289 0.21
290 0.2
291 0.17
292 0.17
293 0.15
294 0.21
295 0.26
296 0.29
297 0.32
298 0.31
299 0.31
300 0.32
301 0.31
302 0.28
303 0.22
304 0.18
305 0.17
306 0.2
307 0.2
308 0.22
309 0.24
310 0.23
311 0.28
312 0.31
313 0.37