Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3DCQ2

Protein Details
Accession S3DCQ2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MLRHISKNQRQTRQPNTATRYHydrophilic
NLS Segment(s)
PositionSequence
104-127KAKRRKTTGTGRMRHMKGVPRRFK
Subcellular Location(s) nucl 16, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG glz:GLAREA_08325  -  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences MLRHISKNQRQTRQPNTATRYFLIQNDEGNFQLRKAPQQDAHIVQTLRGHAANCSREGENIGHSGLETDNVKTTGRRSLHIQKHTCSSCGYPAAKIRQYNWGEKAKRRKTTGTGRMRHMKGVPRRFKNGFQTGVPKDSRGPSKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.78
4 0.74
5 0.69
6 0.6
7 0.55
8 0.46
9 0.42
10 0.38
11 0.32
12 0.29
13 0.27
14 0.28
15 0.24
16 0.25
17 0.22
18 0.17
19 0.22
20 0.2
21 0.23
22 0.25
23 0.3
24 0.3
25 0.35
26 0.4
27 0.38
28 0.39
29 0.38
30 0.34
31 0.29
32 0.28
33 0.24
34 0.2
35 0.18
36 0.15
37 0.13
38 0.19
39 0.19
40 0.19
41 0.21
42 0.19
43 0.19
44 0.21
45 0.2
46 0.15
47 0.14
48 0.13
49 0.1
50 0.09
51 0.1
52 0.07
53 0.08
54 0.07
55 0.06
56 0.07
57 0.08
58 0.09
59 0.09
60 0.1
61 0.16
62 0.16
63 0.17
64 0.22
65 0.32
66 0.39
67 0.48
68 0.5
69 0.44
70 0.51
71 0.5
72 0.45
73 0.37
74 0.3
75 0.24
76 0.27
77 0.26
78 0.22
79 0.26
80 0.32
81 0.34
82 0.35
83 0.33
84 0.37
85 0.4
86 0.42
87 0.44
88 0.46
89 0.47
90 0.53
91 0.63
92 0.62
93 0.67
94 0.66
95 0.65
96 0.65
97 0.71
98 0.73
99 0.73
100 0.7
101 0.7
102 0.75
103 0.7
104 0.67
105 0.6
106 0.59
107 0.59
108 0.64
109 0.66
110 0.63
111 0.7
112 0.7
113 0.73
114 0.73
115 0.71
116 0.64
117 0.58
118 0.61
119 0.57
120 0.59
121 0.53
122 0.45
123 0.41
124 0.44
125 0.47