Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3DBL5

Protein Details
Accession S3DBL5    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-36KSPIGGKHKDLRRPKINHRRRLDSIRRFLYBasic
NLS Segment(s)
PositionSequence
5-27ERKSPIGGKHKDLRRPKINHRRR
Subcellular Location(s) nucl 17, cyto 5, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045518  2EXR  
KEGG glz:GLAREA_00506  -  
Pfam View protein in Pfam  
PF20150  2EXR  
Amino Acid Sequences MPDKERKSPIGGKHKDLRRPKINHRRRLDSIRRFLYFNILPLEIRTEIWEYSLPGSRMLCPRDPPEPERETYTRRSSLAYGTFDQPPPNSQVIYSQTSLYFPRHHQAMKPAALDVCRRAGKLWGWVERETSDVVIYPAPEVIADLERVTRLAYKYTGGWADYDELLVSPHGNGPILRKELAIFKGLEEVLLSHAPEEVSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.75
3 0.77
4 0.77
5 0.76
6 0.79
7 0.83
8 0.85
9 0.87
10 0.88
11 0.86
12 0.85
13 0.83
14 0.85
15 0.84
16 0.83
17 0.83
18 0.8
19 0.73
20 0.65
21 0.58
22 0.55
23 0.45
24 0.38
25 0.31
26 0.25
27 0.23
28 0.22
29 0.25
30 0.18
31 0.17
32 0.16
33 0.14
34 0.13
35 0.15
36 0.15
37 0.13
38 0.15
39 0.19
40 0.17
41 0.17
42 0.18
43 0.21
44 0.25
45 0.28
46 0.28
47 0.27
48 0.29
49 0.34
50 0.38
51 0.37
52 0.39
53 0.39
54 0.38
55 0.4
56 0.4
57 0.39
58 0.4
59 0.43
60 0.37
61 0.34
62 0.35
63 0.29
64 0.3
65 0.3
66 0.27
67 0.24
68 0.24
69 0.25
70 0.25
71 0.25
72 0.21
73 0.18
74 0.19
75 0.18
76 0.15
77 0.13
78 0.16
79 0.19
80 0.21
81 0.2
82 0.17
83 0.16
84 0.17
85 0.19
86 0.17
87 0.15
88 0.13
89 0.15
90 0.17
91 0.17
92 0.18
93 0.23
94 0.27
95 0.27
96 0.26
97 0.25
98 0.23
99 0.24
100 0.24
101 0.19
102 0.18
103 0.17
104 0.16
105 0.16
106 0.19
107 0.18
108 0.25
109 0.29
110 0.29
111 0.31
112 0.32
113 0.33
114 0.3
115 0.3
116 0.23
117 0.18
118 0.12
119 0.09
120 0.09
121 0.08
122 0.08
123 0.07
124 0.06
125 0.06
126 0.05
127 0.05
128 0.06
129 0.06
130 0.07
131 0.07
132 0.07
133 0.07
134 0.08
135 0.08
136 0.1
137 0.1
138 0.12
139 0.13
140 0.14
141 0.15
142 0.18
143 0.19
144 0.16
145 0.16
146 0.14
147 0.16
148 0.14
149 0.14
150 0.1
151 0.09
152 0.09
153 0.09
154 0.08
155 0.06
156 0.08
157 0.09
158 0.1
159 0.1
160 0.15
161 0.21
162 0.24
163 0.24
164 0.22
165 0.23
166 0.28
167 0.3
168 0.28
169 0.22
170 0.19
171 0.24
172 0.23
173 0.21
174 0.16
175 0.14
176 0.15
177 0.16
178 0.15
179 0.1
180 0.12