Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DQ77

Protein Details
Accession B0DQ77   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
247-271GEEGAAKRPRGRPKGSKNRSKGDAABasic
NLS Segment(s)
PositionSequence
243-268SSARGEEGAAKRPRGRPKGSKNRSKG
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018482  Znf-C4H2  
KEGG lbc:LACBIDRAFT_307464  -  
Pfam View protein in Pfam  
PF10146  zf-C4H2  
Amino Acid Sequences MSQHTIQHHQVHQHYVHYSGPQQPLVHHQSIGIVPQDTQRQLQHHQQPQHQLQHQPVPQASGSGTTTVSPLVATGDWTKDLVHLAKTAELKKHALTLQLHTAHILSAHASLEQKGKAIQDVREQRNKLESERTRLLNCLREINEDRDKADLMESTLNKECDDMRNKIAQLTEGDYAIAKSDVDRLRQELGQPPLPTLQSTLDEKTSQYLNERRLNGNESQSHTPTEAQGSSSATGGMKRSAPSSARGEEGAAKRPRGRPKGSKNRSKGDAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.39
3 0.37
4 0.32
5 0.32
6 0.33
7 0.35
8 0.34
9 0.33
10 0.32
11 0.39
12 0.43
13 0.4
14 0.33
15 0.29
16 0.28
17 0.29
18 0.29
19 0.23
20 0.16
21 0.15
22 0.19
23 0.24
24 0.22
25 0.25
26 0.27
27 0.29
28 0.33
29 0.42
30 0.48
31 0.51
32 0.56
33 0.59
34 0.65
35 0.68
36 0.72
37 0.67
38 0.62
39 0.59
40 0.61
41 0.57
42 0.52
43 0.45
44 0.39
45 0.34
46 0.3
47 0.25
48 0.19
49 0.18
50 0.14
51 0.14
52 0.11
53 0.11
54 0.1
55 0.1
56 0.07
57 0.06
58 0.06
59 0.06
60 0.07
61 0.09
62 0.1
63 0.1
64 0.11
65 0.11
66 0.1
67 0.12
68 0.12
69 0.12
70 0.12
71 0.12
72 0.16
73 0.2
74 0.22
75 0.23
76 0.24
77 0.24
78 0.23
79 0.27
80 0.24
81 0.25
82 0.24
83 0.24
84 0.29
85 0.29
86 0.28
87 0.25
88 0.24
89 0.18
90 0.16
91 0.13
92 0.07
93 0.06
94 0.06
95 0.07
96 0.07
97 0.08
98 0.11
99 0.11
100 0.1
101 0.11
102 0.11
103 0.13
104 0.15
105 0.16
106 0.22
107 0.31
108 0.36
109 0.42
110 0.42
111 0.4
112 0.44
113 0.43
114 0.37
115 0.37
116 0.35
117 0.35
118 0.38
119 0.39
120 0.34
121 0.35
122 0.36
123 0.31
124 0.3
125 0.27
126 0.24
127 0.27
128 0.29
129 0.33
130 0.36
131 0.3
132 0.3
133 0.26
134 0.26
135 0.21
136 0.19
137 0.13
138 0.09
139 0.13
140 0.12
141 0.15
142 0.17
143 0.18
144 0.17
145 0.17
146 0.17
147 0.19
148 0.24
149 0.23
150 0.24
151 0.27
152 0.27
153 0.29
154 0.28
155 0.23
156 0.19
157 0.19
158 0.17
159 0.13
160 0.13
161 0.11
162 0.11
163 0.1
164 0.08
165 0.05
166 0.05
167 0.12
168 0.14
169 0.17
170 0.18
171 0.2
172 0.22
173 0.23
174 0.26
175 0.25
176 0.28
177 0.3
178 0.29
179 0.28
180 0.28
181 0.28
182 0.26
183 0.21
184 0.18
185 0.16
186 0.18
187 0.19
188 0.19
189 0.19
190 0.19
191 0.2
192 0.19
193 0.17
194 0.21
195 0.25
196 0.3
197 0.36
198 0.4
199 0.4
200 0.42
201 0.45
202 0.42
203 0.44
204 0.41
205 0.39
206 0.41
207 0.4
208 0.38
209 0.35
210 0.32
211 0.27
212 0.26
213 0.21
214 0.17
215 0.17
216 0.18
217 0.17
218 0.16
219 0.16
220 0.12
221 0.14
222 0.14
223 0.15
224 0.16
225 0.16
226 0.17
227 0.22
228 0.23
229 0.26
230 0.31
231 0.31
232 0.3
233 0.29
234 0.3
235 0.32
236 0.34
237 0.38
238 0.37
239 0.4
240 0.44
241 0.52
242 0.61
243 0.62
244 0.68
245 0.69
246 0.76
247 0.83
248 0.87
249 0.9
250 0.88
251 0.88