Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CPD3

Protein Details
Accession S3CPD3    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
33-74RNDDWHSIRDPKKRKQIQDRLAQRARRKRVKEAKNQNPKPAEHydrophilic
NLS Segment(s)
PositionSequence
43-67PKKRKQIQDRLAQRARRKRVKEAKN
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021833  DUF3425  
KEGG glz:GLAREA_02933  -  
Pfam View protein in Pfam  
PF11905  DUF3425  
Amino Acid Sequences MAKLATTKQASEHIPEMDELVTLENVQHESGVRNDDWHSIRDPKKRKQIQDRLAQRARRKRVKEAKNQNPKPAEQDALITCLSQSHVARNNDASDSSLFNSLNSLDSHRHNEYYQYVEVPPLAPALELPAPLSVLAALWLNGEILGLKSCTTFPCKSLPVSADIPESLRPTTIQLLTLHCPGIDRFPFPKMRDRSIEMSAFLDEEELGRDMIMGPSFWIVPGGASWDPGAWVIDVGFREKWGWLFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.26
4 0.2
5 0.18
6 0.13
7 0.11
8 0.1
9 0.09
10 0.09
11 0.09
12 0.1
13 0.09
14 0.1
15 0.09
16 0.11
17 0.13
18 0.17
19 0.15
20 0.17
21 0.18
22 0.24
23 0.26
24 0.26
25 0.28
26 0.33
27 0.41
28 0.49
29 0.56
30 0.59
31 0.68
32 0.75
33 0.81
34 0.83
35 0.86
36 0.85
37 0.86
38 0.86
39 0.85
40 0.84
41 0.81
42 0.79
43 0.78
44 0.79
45 0.78
46 0.74
47 0.75
48 0.78
49 0.81
50 0.83
51 0.84
52 0.85
53 0.86
54 0.86
55 0.84
56 0.77
57 0.68
58 0.63
59 0.55
60 0.46
61 0.35
62 0.33
63 0.25
64 0.24
65 0.23
66 0.16
67 0.13
68 0.12
69 0.12
70 0.12
71 0.12
72 0.15
73 0.23
74 0.24
75 0.26
76 0.27
77 0.27
78 0.24
79 0.24
80 0.2
81 0.13
82 0.14
83 0.13
84 0.14
85 0.12
86 0.12
87 0.12
88 0.11
89 0.11
90 0.1
91 0.11
92 0.11
93 0.14
94 0.19
95 0.2
96 0.21
97 0.19
98 0.21
99 0.21
100 0.22
101 0.2
102 0.17
103 0.15
104 0.14
105 0.14
106 0.12
107 0.1
108 0.07
109 0.06
110 0.05
111 0.04
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.06
120 0.04
121 0.03
122 0.04
123 0.03
124 0.03
125 0.03
126 0.04
127 0.04
128 0.03
129 0.03
130 0.03
131 0.03
132 0.04
133 0.04
134 0.04
135 0.05
136 0.06
137 0.07
138 0.13
139 0.13
140 0.15
141 0.19
142 0.21
143 0.21
144 0.24
145 0.24
146 0.23
147 0.24
148 0.23
149 0.2
150 0.18
151 0.18
152 0.17
153 0.18
154 0.14
155 0.12
156 0.11
157 0.12
158 0.16
159 0.15
160 0.16
161 0.16
162 0.19
163 0.21
164 0.22
165 0.2
166 0.16
167 0.17
168 0.15
169 0.2
170 0.18
171 0.2
172 0.2
173 0.25
174 0.32
175 0.34
176 0.43
177 0.41
178 0.46
179 0.47
180 0.51
181 0.5
182 0.49
183 0.48
184 0.39
185 0.35
186 0.3
187 0.24
188 0.19
189 0.14
190 0.09
191 0.08
192 0.08
193 0.08
194 0.07
195 0.07
196 0.07
197 0.07
198 0.09
199 0.09
200 0.08
201 0.07
202 0.09
203 0.09
204 0.09
205 0.09
206 0.07
207 0.07
208 0.07
209 0.11
210 0.1
211 0.11
212 0.12
213 0.11
214 0.11
215 0.12
216 0.13
217 0.08
218 0.08
219 0.07
220 0.1
221 0.11
222 0.14
223 0.14
224 0.14
225 0.15
226 0.16