Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3DAP1

Protein Details
Accession S3DAP1   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
193-214LTHSLKKAPGAKKRKKNAEAAEHydrophilic
NLS Segment(s)
PositionSequence
196-209SLKKAPGAKKRKKN
Subcellular Location(s) nucl 18, mito_nucl 12.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
IPR027799  Rtf2_RING-finger  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
KEGG glz:GLAREA_00209  -  
Pfam View protein in Pfam  
PF04641  Rtf2  
CDD cd16653  RING-like_Rtf2  
Amino Acid Sequences MGNDGGSIPTRRELVKNAARALNTSEFKAKEQEAQGHAWTYCPLSNRPLVAPIVSDCAGTLYNKDAILEQLLPKDDDVPAPVIKEKEEVLQGRVKGLRDIVEVKFTVVKEGKEEEKKICPITSKELGPTTKSVYLVPCGHAFSDVAIREVAGDTCVECNEPYKSDDVITILPLAKEDISRLAARMAKLKESGLTHSLKKAPGAKKRKKNAEAAEPTETSSANEPTSNPKTKYKLVGNDKVKSSSGASTPNVTSNGIKNAATASLTAKVLDEQEERNKRRKLGLNDNLKSLFSSGGYSAQAHKGGDFMTRGFSLPKKTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.42
3 0.46
4 0.49
5 0.5
6 0.48
7 0.47
8 0.47
9 0.46
10 0.39
11 0.36
12 0.37
13 0.34
14 0.36
15 0.39
16 0.35
17 0.33
18 0.36
19 0.41
20 0.38
21 0.39
22 0.39
23 0.37
24 0.35
25 0.29
26 0.25
27 0.21
28 0.2
29 0.2
30 0.21
31 0.22
32 0.26
33 0.27
34 0.27
35 0.28
36 0.27
37 0.24
38 0.23
39 0.19
40 0.2
41 0.18
42 0.17
43 0.13
44 0.13
45 0.14
46 0.13
47 0.13
48 0.11
49 0.13
50 0.13
51 0.14
52 0.13
53 0.13
54 0.15
55 0.16
56 0.15
57 0.15
58 0.17
59 0.17
60 0.16
61 0.17
62 0.15
63 0.14
64 0.14
65 0.14
66 0.13
67 0.14
68 0.17
69 0.16
70 0.16
71 0.16
72 0.15
73 0.15
74 0.2
75 0.2
76 0.2
77 0.24
78 0.24
79 0.26
80 0.28
81 0.26
82 0.22
83 0.22
84 0.2
85 0.18
86 0.22
87 0.19
88 0.2
89 0.19
90 0.19
91 0.2
92 0.19
93 0.21
94 0.2
95 0.19
96 0.18
97 0.21
98 0.27
99 0.29
100 0.32
101 0.3
102 0.33
103 0.36
104 0.35
105 0.33
106 0.3
107 0.28
108 0.32
109 0.33
110 0.29
111 0.28
112 0.31
113 0.31
114 0.29
115 0.28
116 0.24
117 0.22
118 0.22
119 0.2
120 0.17
121 0.2
122 0.19
123 0.2
124 0.17
125 0.16
126 0.15
127 0.14
128 0.13
129 0.09
130 0.13
131 0.11
132 0.1
133 0.1
134 0.09
135 0.09
136 0.09
137 0.09
138 0.05
139 0.05
140 0.04
141 0.05
142 0.05
143 0.05
144 0.05
145 0.07
146 0.07
147 0.09
148 0.09
149 0.11
150 0.11
151 0.11
152 0.11
153 0.11
154 0.1
155 0.09
156 0.09
157 0.08
158 0.08
159 0.07
160 0.08
161 0.06
162 0.06
163 0.06
164 0.07
165 0.09
166 0.09
167 0.09
168 0.12
169 0.14
170 0.14
171 0.2
172 0.19
173 0.19
174 0.2
175 0.2
176 0.2
177 0.19
178 0.21
179 0.19
180 0.21
181 0.2
182 0.23
183 0.26
184 0.24
185 0.25
186 0.31
187 0.34
188 0.42
189 0.52
190 0.58
191 0.65
192 0.74
193 0.82
194 0.79
195 0.8
196 0.77
197 0.76
198 0.74
199 0.69
200 0.63
201 0.53
202 0.49
203 0.4
204 0.34
205 0.24
206 0.19
207 0.16
208 0.12
209 0.13
210 0.13
211 0.2
212 0.27
213 0.33
214 0.33
215 0.38
216 0.43
217 0.46
218 0.53
219 0.52
220 0.55
221 0.58
222 0.64
223 0.65
224 0.66
225 0.64
226 0.59
227 0.52
228 0.44
229 0.37
230 0.3
231 0.25
232 0.25
233 0.23
234 0.24
235 0.25
236 0.26
237 0.25
238 0.24
239 0.23
240 0.21
241 0.25
242 0.23
243 0.22
244 0.19
245 0.19
246 0.18
247 0.17
248 0.14
249 0.12
250 0.13
251 0.13
252 0.13
253 0.13
254 0.13
255 0.14
256 0.17
257 0.17
258 0.18
259 0.29
260 0.39
261 0.43
262 0.51
263 0.55
264 0.54
265 0.61
266 0.65
267 0.65
268 0.66
269 0.71
270 0.73
271 0.71
272 0.73
273 0.65
274 0.56
275 0.47
276 0.37
277 0.28
278 0.18
279 0.17
280 0.13
281 0.15
282 0.16
283 0.17
284 0.19
285 0.22
286 0.24
287 0.22
288 0.21
289 0.19
290 0.18
291 0.21
292 0.19
293 0.16
294 0.17
295 0.18
296 0.19
297 0.22
298 0.25